%?... Special Texts
%?... special texts for date exclusion
%?... special texts for text replacement
%?[date] special texts
%[format]K[date] special text
%[format]?[date] special texts
%[format]N[date] special text
%[format]D[date] special text
%k[date] special text
%[format]U[date] special text
%[format]M[date] special text
%[format]Y[date] special text
%[format]?[date] special texts
%?[date] special texts
%[format]?[date] special texts
%[format]?[argument] special texts
%[format]?[argument] special texts
%n[argument] special text
%[format]j[argument] special text
%[format]bargument special text
%[format]?argument special texts
%[format]?argument special texts
%[format]-[argument] special text
%? special texts
%![argument] special text
%?... Special Texts
This file documents gcal, a program for calculating and printing calendars.
Gcal displays hybrid and proleptic Julian and Gregorian calendar sheets, respectively, for one month, three months or a whole year. It also displays eternal holiday lists for many countries around the globe, and features a very powerful creation of fixed date lists that can be used for reminding purposes. Gcal can calculate various astronomical data and times of the Sun and the Moon for at pleasure any location, precisely enough for most civil purposes. Gcal supports some other calendar systems, for example the Chinese calendar, the Hebrew calendar and the civil Islamic calendar, too.
This is Edition 3.6 of Gcal, an Extended Calendar Program,
24 June 2000, for the 3.6 version
of the GNU implementation
of cal and calendar.
Any suggestions, improvements, extensions, bug reports, donations, proposals for contract work, and so forth are welcome! Please send them directly to my eMail address esken@gmx.net. If you like my work, I'd appreciate a postcard from you!
———————————–oOO \\\_”/ OOo————————————— Thomas Esken O (/o-o\) O eMail: esken@gmx.net Im Hagenfeld 84 (( ^ )) Phone: +49 251 232585 D-48147 Muenster; Germany \____) ~ (____/ MotD : 2old2live, 2young2die
Appendices
Indices
--- The Detailed Node Listing ---
Invoking Gcal
Command line arguments
Options
Commands
Fixed Dates
Resource file
Further date part attributes
Gcal Utilities
Regular Expressions
Special Texts
Exclusions
Exclusions with date argument
Exclusions without any argument
Replacements
Replacements with date argument
Replacements with other argument
Replacements without any argument
Obsolete Special Texts
Coding Scheme
The reason why I have written Gcal was mainly to have an off-line tool1 which is able to display Julian and Gregorian calendar sheets in a highly flexible and internationalized manner, fixed date lists for reminding purposes and country respectively territory specific holiday lists. At a later stage, Gcal was extended in the way to perform some basic astronomical calculations like Moon phase, moonrise, moonset and other Moon based data, sunset, sunrise, different twilight times and other Sun based data, zodiacal markers, solar and lunar eclipses, equinoxes and solstices. Other gimmicks like biorhythm calculation and the computation of a distance between two geographical point locations and their course angles (true tracks) are also done by it now, plus a lot more.
The accuracy of most of the astronomical calculations done by Gcal is low because it is really hard to perform accurate astronomical predictions more that 100 years ahead. Of course, this also has consequences for some country specific holidays which are based on such astronomical calculations. So it is really possible that some output may differ from the real astronomical date and time of the event calculated, and that by one or more minutes/hours/days. This can happen when the date of a real astronomical event occurs near around midnight. So don't be surprised! Strictly speaking, take all such astronomically based output as a more or less good approximation of the true value, but do not rely on it!
Because Gcal is not primarily designed for the purpose of having a high precision astronomical calculation tool, the world currently has to live with these limitations. But if you have C source code functions, which
and you want to grant them to the public, I would be very pleased if you would contact me so I am able to implement your result to a next release of this software.
Some words to the build-in country specific holidays now...
As you certainly know, there are several other calendar systems actually existing around the world among the Gregorian calendar. The Gregorian calendar that Gcal mainly represents as a software is only one calendar of many others, but it is that one which is most respected around the world today. Even countries which use another calendar system officially mostly respect the Gregorian calendar for civil and administrative purposes.
But when Gcal offers the ability to include holidays from a definite country
into its eternal holiday list, it is possible that not all holidays are
displayed which are respected in that country. One reason is that my
various sources simply don't tell me about the existence of a holiday.
A second reason is that the holiday is just designed or changed or removed
by political or society reality during Gcal's development phase. And another
reason is that the method to calculate a holiday is not build-in Gcal yet.
This case is marked by a ‘#’ character behind the country name in the
list of countries, which are respected by Gcal.
See Calendar option --cc-holidays=cc[_tt][+...],
for the above mentioned list.
The holidays of early years that are included into the eternal holiday
list —i.e. those within the period AD 30 until the midth
of the 20th century— are certainly not accomplishing the requirements of
historians to such a list. Gcal cannot be understood as a complete and
historically correct data base, and it is not designed for that purpose!
This is caused by the fact that the territorial borders and names of the
national structures and the settlement in earlier times was partly quite
different as it is nowadays. Moreover, I am yet lacking reliable information
that tells me the precise date of the introduction of a holiday in a region.
Here I appeal to the historians to support me with the concrete country
and culture based data if they are bothered by this fact and they want to
have it removed.
Still unsupported alive and major calendar systems, respectively methods to derive country specific holidays from them, are:
Even if the list of supported countries seems to be almost complete if you compare it with the actual list of all nations existing around the world, you should note that there are still some countries missing! If you can grant me support to complete Gcal's list of respected countries, or if you would work out or have C functions which manage the missing calendar systems, I also would be very pleased about if you would contact me.
I have recorded the country specific holiday dates as good as I can, but I cannot guarantee that I did not made any mistakes while I hacked them in. So it is possible that some country specific holiday lists contain errors.
Well, if you think that I forgot to provide Gcal with the specific holidays of a/your country, or you think that a country specific holiday list is incomplete, or you think that some of the already implemented holidays are wrong, please feel free to send me a complete list of all the holidays which are celebrated in this country respectively to give me hints how to correct or to complete them!
Such a list should ideally include the following information:
By the way, if the holiday is tied to the Easter Sunday's date, please tell me whether you mean the Easter Sunday of the Christian Western churches or the Easter Sunday of the Orthodox Christian Eastern churches.
Valentine's day, Father's day, Mother's day.
The Islamic holidays inserted into the country specific holiday list are
calculated arithmetically, not astronomically. This is what people call
the civil Islamic lunar calendar. This type of calendar is just a
rough estimate of the religious Islamic lunar calendar, which is determined
quite astronomically. So don't be surprised too much if some holiday dates
differ from the religious Islamic calendar about
+/- 1...2
days in some years.
The main difficulty to implement the religious Islamic calendar correctly
into Gcal are the several different criteria that are existing for the first
sighting of the crescent Moon after a New Moon phase — that event, which
defines the beginning of a new (lunar) month in the religious oriented Islamic
calendar. So on the one hand, there are quite astronomically-based
criteria, and on the other hand, there are also quite religiously-based
criteria. Furthermore, the local predominant weather conditions, the
geographical co-ordinate of the observer's location and the kind of
the observance method used also affect these criteria. Moreover, to
render all more difficult, I as yet do not have any reliable information
that tells me which kind of criteria is used in the countries (around
60 world-wide) which respect this religious Islamic calendar. So due
to all the above mentioned facts of problematic nature, this religious
Islamic calendar is not included into Gcal yet.
The Chinese (and Japanese) holidays also inserted into the country specific holiday list are calculated by using that algorithm as it is used by the Purple Mountain Observatory in Nanjing to determine the astronomical lunisolar Chinese calendar. This calendar is obligatory for (the Peoples Republic of) China since 1929 and is determined annually always new. Nevertheless and strictly speaking, in the historic reality and depending on the region, the Chinese calendar, especially in the 17th and 18th century, was either calculated using this modern algorithm, or by the use of a different method, so that a different calendar structure for one and the same year was possibly calculated as result.
And last...
This manual shows the possible use of the Gcal program only briefly and deliberately renounces to present the topics that are covered by this software arranged in a novel-like style. The use of Gcal is illustrated in an exemplary manner only! A detailed description of all possible use is inexpedient here because there are simply too many of such possibilities which are caused by the existing variety of combinations of all useable modes of operation.
Furthermore, this manual does not contain detailed explanations about the calendar systems supported by Gcal, nor it can be understood as a reference-book for the basics in celestial mechanics or spherical trigonometry! A detailed discussion of the above topics is completely beyond the scope of this manual. If you are interested to learn more about these subjects, you unfortunately have to read the specific pertinent literature.
Any further errors occurring in the output of the above mentioned holiday lists and in the astronomical calculations are my own fault, and are not intended to offend members of any culture, religion or profession!
Apart from the usual and well known calendar functions like the output of a month or a year calendar sheet, or the output of an eternal holiday list, Gcal, the Gregorian calendar program of the Free Software Foundation, offers the facility to display fixed dates on the day of their occurrence and to remind or inform the user about them. So it is imaginable after booting the computer or starting the work session, that the user is informed on screen or by means of electronic mail about all holidays or appointments which are observed or scheduled for that day.
The period, for which Gcal respects occurring fixed dates, may be freely selected by the user. So it is possible that Gcal displays all fixed dates which occur on tomorrow's date, the whole week, the whole month or in the whole year. Fixed dates which occur on a selected date of the year, and those that occur relative to another given date, are displayed either related to this single date only, or in listed manner starting on this date and ending on the actual date3.
There are two methods to display a preview of fixed dates4 or retrospective view of fixed dates5. On the one hand, Gcal can be started by using an option that sets the system date of the computer to the given date during the time of the program execution with the result, the program assumes the system date is set to this given date and the user can define any needed period that should be respected by an option. On the other hand, Gcal can be started with a command which forces the program to use a different year instead of the actual year, so Gcal will display all occurring fixed dates for this particular year. But this limits the user in that it disables defining any needed period by an option, because the period is always set to the whole year by default.
Gcal isn't only able to display fixed dates which are stored for a concrete date, e.g. ‘Fixed date on 1st December 1995’, rather than fixed dates occurring periodically again and again. So it is possible to define repeated events like ‘This fixed date occurs every day in May 1995’ or ‘Every 15th November in any years’. These fixed date definitions are stored in resource files and whenever Gcal is started, an option to evaluate the necessary resource files can be given.
Once the user has set his/her preferred command line arguments for querying the fixed dates data base, it is possible to store them in a response file or shell script file. A response file contains all arguments delivered to Gcal, but unlike a shell script file, such a response file isn't executable; it is only a pool of command line arguments which can be preloaded if needed. A shell script file can be started and calls Gcal directly with all arguments stored in it and all arguments which are given further in the command line.
A list of all usable command line arguments and their descriptions can be found in the next chapter, which helps one to use Gcal in the most efficient and productive way possible. After it follows the description how to use the eternal holiday list, and in the succeeding chapter, how to use the fixed date list. Comprehensive explanations respectively summaries and tables to definite details or themes from other disciplines can be found in the numerous appendices.
Gcal is a command line oriented program. It is usually called from the shell6 and processes given arguments that are options and commands. Options must be given before commands, i.e. you must call Gcal like this:
gcal [ [option...] [%date] [@file...] ] [command]
If Gcal is started without any options or commands, a calendar of the current month is displayed. If the calendar of a definite year is wanted, the year must be fully specified, e.g. ‘gcal 94’ displays a year calendar of the year 94, not of the year 1994.
If two arguments are given in the command part, the first argument denotes the month, and the second argument denotes the year. In case any incorrect commands are given running Gcal, the program will use internal defaults.
In the English program version, Gcal assumes the Gregorian Reformation has occurred in 1752 on the 3rd of September. See Genesis of the Gregorian Calendar, and Aspects in Internationalization, for further details.
This section describes all command line arguments processed by Gcal. Four different types of command line arguments exists. One important type of arguments are the options which control how Gcal behaves. Other types of arguments are the %date and the @file options. The %date option sets the period Gcal shall work on to any starting date; the @file option preloads options and commands from a response file. The most important arguments are the commands which control the periods Gcal respects.
An option is defined by a leading switch character; either the ‘-’ (dash) or the ‘/’ (slash) character for traditional short-style options, or ‘--’ for mnemonic long-style options; a command may not have a leading switch character. Options7 must be given before commands!
Depending on operating system and used shell, some of the arguments and texts given in command line must be quoted by ‘"’ or ‘'’ characters respectively protected or depreciated by a ‘\’ character to avoid expansion by the shell.
Here is an incomplete list of characters which must potentially be protected:
‘(’, ‘)’, ‘<’, ‘>’, ‘[’, ‘]’, ‘{’, ‘}’, ‘\’, ‘|’, ‘$’, ‘@’, ‘!’, ‘&’, ‘~’, ‘"’, ‘'’, ‘`’, ‘;’
The options processed by Gcal can be grouped into four major option classes. The options of the common option class are the standard options all GNU software should implement at least partially. The global option class contains options which affect the program output. The options of the calendar option class control the calendar layout, and the options of the fixed date option class control the fixed date layout and intensity.
Gcal supports both short-style options and GNU long-style options. Traditional short-style options are indicated by a single switch character, and trailed by the option character itself and perhaps a modifier or an argument. The most single character options8 can be composed into a single command line word: -Ax is equivalent to -A -x. GNU long-style options are indicated with ‘--’, and trailed by the mnemonic option name itself and perhaps an argument. Long-style options and their arguments may be abbreviated if done unambiguously. When a long-style option takes an argument, connect the option name and the argument with ‘=’.
Brackets ([ and ]) indicate in the following tables, that an option takes an optional argument. The ‘|’ character is used to separate several arguments from each other.
Gcal processes the GNU long-style options in a special, non-standard way. There are five different types of long-style options:
Traditional short-style options differ as follows:
--long-help=long-help
displays the extended help text for the long option --long-help.
If the argument only consists of the single ‘?’ character or is
no valid long-style option name, a list of all valid long-style option names
is displayed.
If no PAGER environment variable is set or if its contents is invalid, Gcal tries to use the less pager; if this program cannot be found during scanning the PATH environment variable, Gcal tries to use the more pager, if this program cannot be found, the pg pager in the same way9. See Environment Variable PATH.
If all these actions fail, Gcal will use its simple, built-in pager. If the internal pager is used, Gcal detects the number of lines shown before it prompts and waits for user input by using these methods:
On MS-DOS, OS/2 and some other operating systems, Gcal uses a system dependent low-level function and respects the reported values.
The text argument must be a (‘:’) colon-separated text which is structured in this way: seq1_start:seq1_end:seq2_start:seq2_end. The first sequence is used for highlighting/marking an actual day, the second for a holiday. The sequences must be given in form of a sequence pair; seq?_start enables the highlighting/marking, seq?_end disables it. Only two sequence pairs will be processed, others are ignored. Either highlighting sequence pairs or marking character pairs may be defined, i.e. using them both in a mixed couple is not permitted!
For example:
-H \x20:\x20:\x1:# respectively
--highlighting=\x20:\x20:\x1:#
marks the actual day like ‘\x20actual date\x20’14 and the holiday date like ‘\x1holiday date#’ using the given marking characters.
-H \x1b[34;42m:\x1b[0;40m or
-H \033[34;42m:\033[0;40m or
-H \E[34;42m:\E[0;40m
defines a starting ANSI escape highlighting sequence ‘\x1b[34;42m’ used for actual day and ending ANSI escape highlighting sequence ‘\x1b[0;40m’ with no given highlighting sequence for holidays, so default highlighting sequences for holidays are used (non-given entries are always skipped). Please note the last abstract of this text part which informs you more detailed of this context. See Environment Variable GCALANSI, too.
Control code definitions may contain any printable characters. Non-printable
characters may be encoded in octal or hexadecimal notation. The abbreviation
‘\E’ directly encodes the escape character (octal \033 respectively
hexadecimal \x1B).
A character can be encoded octal by typing ‘\nnn’ (backslash-octal digit(s)), where n must be a valid octal digit (0...7). Normally, three octal digits must be given. If the octal character code consists of one or two octal digits, leading zeroes must be added, except the case, where the encoded octal character is given at last in the single sequence.
A character can be encoded hexadecimal by typing ‘\xnn’ (backslash-x hexadecimal digit(s)), where n must be a valid hexadecimal digit (0...9A...Fa...f). Normally, two hexadecimal digits must be given. If the hexadecimal character code consists of one hexadecimal digit, a leading zero must be added, except the case, where the encoded hexadecimal character is given at last in the single sequence.
If the sequence separator character, thus the ‘:’ (colon) character
itself, is used as a marking character, it must be encoded either octal
by \072 or hexadecimal by \x3A.
If the C Preprocessor symbol USE_PAGER was defined and the
output of the program is redirected or used in a pipeline, the highlighting
sequences are automatically converted into the according marking characters;
if USE_PAGER was not defined, they remain untouched.
Incomplete or non-given highlighting sequences will be replaced by internal
default ANSI escape highlighting sequences if a GCALANSI
environment variable is defined; otherwise completely replaced by their
according marking characters.
See Environment Variable GCALANSI.
--mail=esken@gmx.net
If no address is given, Gcal tries to send the eMail by using the following methods:
Generally, Gcal does not send electronic Mails whose message body is empty! An informational message will be shown on the standard error channel if this case occurs.
All highlighting sequences produced by Gcal itself are always disabled respectively automatically converted into the according marking characters if an eMail must be send; no matter if the --force-highlighting option was given or not. This behavior of Gcal is an imperative necessity, because it is possible that the mail program cannot perform the mailing correctly. Please pay attention in this context to the further explanations concerning the limitations of the text part of a resource file line (see Text part of a line).
If an environment variable MAILPROG is defined and set, its contents will be used as the program name of the mailer instead of the standard name mail. See Environment Variable MAILPROG, for more information.
The cc argument is a two-letter country code as defined by the ISO-316616 like ‘BE’ for Belgium or ‘ES’ for Spain. See the pertinent literature for more details.
In some cases, such a country code may be trailed by a two-letter territory code tt for better specification, which is separated by a ‘_’ character from the country code.
You can use more than one country code cc[_tt] by connecting them with a ‘+’ character, e.g.:
--cc-holidays=be+Fr+IT resp.,
-q be+Fr+IT
includes all the country specific holidays given in the preceding argument into the eternal holiday list, i.e. Belgian, French and Italian holidays.
Actually, Gcal respects the following country codes, at which countries marked by a ‘#’ character have only an incomplete recording of holidays:
ADAEAFAGAIALAMAN_BOAN_CUAN_MAAN_SAAOARASATAU_CTAU_NTAU_QUAU_SAAU_SWAU_TAAU_VIAU_WAAWAZBABBBDBEBFBGBHBIBJBMBNBOBRBSBTBVBWBYBZCA_ALCA_BCCA_MACA_NBCA_NFCA_NSCA_NWCA_ONCA_PECA_QUCA_SACA_YUCCCDCFCGCH_AGCH_AICH_ARCH_BECH_BLCH_BSCH_FRCH_GECH_GLCH_GRCH_JUCH_LUCH_NECH_NWCH_OWCH_SGCH_SHCH_SOCH_SZCH_TGCH_TICH_URCH_VDCH_VSCH_ZGCH_ZHCICKCLCMCNCOCRCUCVCXCYCZDE_BBDE_BEDE_BWDE_BYDE_HBDE_HEDE_HHDE_MVDE_NIDE_NWDE_RPDE_SHDE_SLDE_SNDE_STDE_THDJDKDMDODZECEEEGEHERESETFIFJFKFMFOFRGAGB_ENGB_NIGB_SLGDGEGFGHGIGLGMGNGPGQGRGSGTGUGWGYHKHMHNHRHTHUIDIEILINIQIRISITJMJOJPKEKGKHKIKMKNKPKRKWKYKZLALBLCLILKLRLSLTLULVLYMAMCMDMGMHMKMLMNMOMPMQMRMSMTMUMVMWMXMYMZNANCNENFNGNINLNMNONPNRNUNZOMPAPEPFPGPHPKPLPMPNPRPTPWPYQARERORURWSASBSCSDSESGSHSISJSKSLSMSNSOSRSTSVSYSZTCTDTGTHTJTKTMTNTOTRTTTVTWTZUAUGUS_AKUS_ALUS_ARUS_AZUS_CAUS_COUS_CTUS_DCUS_DEUS_FLUS_GAUS_HIUS_IAUS_IDUS_ILUS_INUS_KSUS_KYUS_LAUS_MAUS_MDUS_MEUS_MIUS_MNUS_MOUS_MSUS_MTUS_NCUS_NDUS_NEUS_NHUS_NJUS_NMUS_NVUS_NYUS_OHUS_OKUS_ORUS_PAUS_RIUS_SCUS_SDUS_TNUS_TXUS_UTUS_VAUS_VTUS_WAUS_WIUS_WVUS_WYUYUZVCVEVGVIVNVUWFWSYEYTYUZAZMZW| $ gcal -i- -| -| September 1994 -| Su Mo Tu We Th Fr Sa -| 1 2 3 -| 4 5 6 7 8 9 10 -| 11 12 13 14 15 16 17 -| 18 19 20 21 22 23 24 -| 25 26 27 28 29 30 |
To obtain the special calendar format, start Gcal with the -i respectively --type=special option:
| $ gcal -i -| -| September 1994 -| -| Sunday 4 11 18 25 -| Monday 5 12 19 26 -| Tuesday 6 13 20 27 -| Wednesday 7 14 21 28 -| Thursday 1 8 15 22 29 -| Friday 2 9 16 23 30 -| Saturday 3 10 17 24 |
Without specifying the --orthodox-calendar option, Gcal is unable to display Gregorian years later than 2799 in the correct way for the Eastern churches, because they use a different scheme for calculating the leap years. The method for computing leap years within the common Gregorian calendar, which Gcal uses by default, is as follows:
A leap year is any year which number can be divided by 4 without a remainder, and years ending in hundreds are no leap years unless they are divisible by 400.
But the Eastern Orthodox churches compute leap years within the Gregorian calendar by using another rule:
A leap year is any year which number can be divided by 4 without a remainder, and years ending in hundreds are leap years, if a remainder of 2 or 6 occurs when such a year is divided by 9.
The first difference therefore occurs in the year 2800 which is a leap year
in the common Gregorian calendar, but an ordinary year only in the calendar
as used by the Eastern Orthodox churches.
For example:
--starting-day=Sunday or --starting-day=7 or -s SUNDAY or -s sund or -sSu or -s 7
thus all specifies the Sunday (1==Mon, 2==Tue ... 7==Sun).
If the -s today option (or --starting-day=today)
or the -s 0 option (or
--starting-day=0) is given, the starting day of the week
is set to the actual weekday as it is delivered by the system date.
See Aspects in Internationalization,
for more details.
If no --time-offset=argument option is given, the astronomical data that is inserted into the eternal holiday list by the --astronomical-holidays option (see Calendar option --astronomical-holidays), and all Sun and Moon related special texts are always calculated for 0 o'clock Universal time (UTC/GMT), thus civil midnight time.
See Sun data, and Moon data, likewise Moon phase, for further information.
The argument is either the ‘t’ or the ‘@’ character
—where ‘t’ means a relation to the actual local time18 and ‘@’ denotes a
relation to the actual Universal time—, or one of these characters followed
by a displacement value, or only a displacement value which has to be
specified either by using the
[+|-]mmmm format or the
[+|-]hh:[mm] format.
[+|-]mmmm adds respectively subtracts
the specified amount of minutes mmmm from the base time value 0
o'clock Universal time (range 0...9999), while
[+|-]hh:[mm] adds respectively
subtracts the given amount of hours hh (range 0...99)
and minutes mm (range 0...59) from the base time value
0 o'clock Universal time. The displacement value is always added to the
base time value 0 o'clock Universal time in case it is specified without
a +|- sign.
For example, the --time-offset=+1: option causes that while displaying eternal holiday lists and fixed date lists, the time 0 o'clock of the timezone GMT-1 (== CET) is used as the base time by the astronomical functions instead of the base time 0 o'clock Universal time (== GMT).
For example, the --time-offset=t-2: option causes that while
displaying eternal holiday lists and fixed date lists, the time that is
two hours earlier than the actual local time is used as the base time by the
astronomical functions instead of the base time 0 o'clock Universal time
(== GMT). For such a kind of relation, the term relative time
offset value will be used in the further context.
For example, the --transform-year=-543 option causes that while displaying calendar sheets, eternal holiday lists and fixed date lists, the year 543 BC is used as the base year of the calendar instead of the year AD 1. This results in the case that —for example— for the year 1999 (Christian era), the year number 1999 is not used in the above mentioned outputs, but the year number 2542 which is used in the western oriented Thai calendar.
Nevertheless, Gcal does not respect the
--transform-year=argument option when using the
actual date modifier %date
(see Actual date modifier),
the commands
(see Commands),
and the fixed date entries in a resource file
(see Date part of a line).
There, all references made to a definite year are always treated in the way
that the year AD 1 is the base year of the calendar, so in fact it
is only possible to use references based on the Christian era.
If Gcal is called with the --gregorian-reform=1582 option, it assumes the Gregorian Reformation has occurred from 5th till 14th October 1582.
If Gcal is called with the --gregorian-reform=1700 option, it assumes the Gregorian Reformation has occurred from 19th till 28th February 1700.
If Gcal is called with the --gregorian-reform=1752 option, it assumes the Gregorian Reformation has occurred from 3rd till 13th September 1752.
If Gcal is called with the --gregorian-reform=1753 option, it assumes the Gregorian Reformation has occurred from 18th till 28th February 1753.
In case another period shall be respected, it can be arranged by the option argument like ‘yyyyy,mm,first-day,last-day’. If the Gregorian Reformation has occurred for example on the 7th till the 17th April 1802, this can be arranged as follows:
--gregorian-reform=1802,4,7,17
Gcal is able to represent so-called proleptic calendars of a definite calendar system. This means, Gcal only uses a definite calendar system during a definite period, although there was a change to another calendar system in the historic reality during this definite period. The following proleptic calendar systems are actually supported by Gcal:
Please note that it is possible to corrupt the calendars likewise the
fixed date feature logically (which works correctly now for the year
in which the Gregorian Reformation has occurred) if the argument of the
--gregorian-reform option is not used with care.
Actually, three fixed default date formats are supported, and that for German users, U.S. American users and for users in Great Britain.
If Gcal is called with the --date-format=de option,
the ‘%<2#K, %1%>2*D%2 %<3#U %>04*Y’ date format text is used.
This result in that a date is displayed by using the
‘ww, dd mmm yyyy’ ordering, for
example ‘Sa, 28 Aug 1999’.
If Gcal is called with the --date-format=us option,
the ‘%<3#K, %<3#U %1%>2&*D%2 %>04*Y’ date format text is used.
This result in that a date is displayed by using the
‘www, mmm dd yyyy’ ordering, for
example ‘Sat, Aug 28th 1999’.
If Gcal is called with the --date-format=gb option,
the ‘%<3#K, %1%>2&*D%2 %<3#U %>04*Y’ date format text is used.
This result in that a date is displayed by using the
‘www, dd mmm yyyy’ ordering, for
example ‘Sat, 28th Aug 1999’.
In case another format text shall be respected, this format text can either be set in the GCAL_DATE_FORMAT environment variable20, or it can be arranged by the option argument text. For example, ‘--date-format='%Y %D %>02*M ; %1(%>5u#K)%2'’ displays a date by using the ‘[[[y]y]y]y [d]d mm ; (wwwww)’ ordering, thus for example ‘1999 28 08 ; (SATUR)’. See Environment Variable GCAL_DATE_FORMAT, for further information.
The format text may contain on the one hand all characters which can be managed by Gcal, and on the other hand character replacement instructions and format elements which are transformed into their according values at run-time. Some format elements may have a format instruction which is called format in the further context. See Format Instruction, for the detailed description of the format instruction and its components.
A minimum date format text must contain the following format elements minimum:
The day number, one component of the month group, the year number and both components of the highlighting group.
A weekday name format element may be included optionally into the date format text. The following format elements and character replacement instructions are currently supported:
%[format]D%[format]Y%[format]KMonth group (exactly one member must be defined):
%[format]M%[format]UHighlighting group (all members must be defined and %1
must be specified before %2):
%1%2Character replacement instructions:
_\_\%\\See Table of Obsolete Date Formats,
and
Table of Obsolete Date Format Elements,
for further information.
For example, a ‘ÄäÖöÜüßß’ option argument causes the correct conversion of the preceding special characters in an individual date format, which has a style format instruction component, and that, how they are used by the character set used in Germany.
A date variable name dvar consists of a single, case-insensitive letter21. In a definition, this name is trailed by the assignment operator character ‘=’, and the numerical values of month mm (or a short, three characters month name, e.g. ‘Jan’, ‘Feb’...) and day dd, this variable has to store22.
For example:
--date-variable=a=1127:c=a respectively
-v a=1127:c=a
stores the 27th November into the global date variable a and into the global date variable c.
A text variable name tvar consists of the ‘$’ prefix and a single, case-insensitive letter.
A text variable is defined as follows:
Indeed, Gcal executes external commands only if the --execute-command option is given at program start-up. See Fixed date option --execute-command, for more details.
The text which appears at the right side of one of the valid assignment operator characters may reference names of already defined global text variables. These references are converted to the according textual values just before the assignment is performed by Gcal.
A global text variable is defined with an empty contents in case no text appears at the right side of one of the valid assignment operator characters.
For example:
--text-variable=$a=foo:$c=$a respectively
-r $a=foo:$c=$a
stores the ‘foo’ text into the global text variable $a and into the global text variable $c.--text-variable=$a\:foo:$c?bar respectively
-r $a\:foo:$c?bar
stores the uninterpreted output of the foo command into the global text variable $a, and the interpreted output of the bar command into the global text variable $c.
You may depreciate the special meaning of the ‘:’ separator character —in case this character itself is needed— by placing a ‘\’ (backslash) character before it, e.g. ‘\:’. If you need the ‘\:’ characters themselves, you have to protect the ‘\’ (backslash) character by another ‘\’ (backslash) character, e.g. ‘\\:’.
You may depreciate the special meaning of the ‘$’ prefix character —in case this character itself is needed in the text— by placing a ‘\’ (backslash) character before it, e.g. ‘\$’. If you need the ‘\$’ characters themselves in the text, you have to protect the ‘\’ (backslash) character by another ‘\’ (backslash) character, e.g. ‘\\$’.
Each time a ‘_’ (underscore) character is found in argument, this character is replaced by a real ‘ ’ (space) character.
You may depreciate the special meaning of the ‘_’ (underscore) character
—in case this character itself is needed— by placing a ‘\’
(backslash) character before it, e.g. ‘\_’. If you need the ‘\_’
themselves, you have to protect the ‘\’ (backslash) character by another
‘\’ (backslash) character, e.g. ‘\\_’.
And causes on the other hand, that the number that is given as argument is used as factor for computing the shadow length of a vertical pole by the Sun oriented special texts. The option argument must be a rational number in range 0.0...+90.0, which declares the shadow length. For example, you can detect the time when the shadow length of vertical pole is three and a half times longer than the shadow length that appears at astronomical noon if you use --adjust-value=3.5.
The following example is used to explain this. It calculates the time the astronomical twilight ends for the location Münster, Germany, during some days in May 2000, and that with and without the --limit option in each case:
| $ gcal %20000506 -f/dev/null -cxl4+ \ > -#'0*d1#999_%s9+5158+00738,120' -| -| Sun, May 7th 2000: 23:52 -| Mon, May 8th 2000: 23:57 -| Tue, May 9th 2000: 00:01 -| Wed, May 10th 2000: 00:06 $ gcal %20000506 -f/dev/null -cxl4+ --limit \ > -#'0*d1#999_%s9+5158+00738,120' -| -| Sun, May 7th 2000: 23:52 -| Mon, May 8th 2000: 23:57 -| Tue, May 9th 2000: **:** -| Wed, May 10th 2000: **:** |
As one can see well in the above example, the output for the days since 9th May differs in that the times shown without the --limit option obviously exceeded the civil midnight time and actually cannot happen during these days, whereas no times are shown for the days since 9th May if the --limit option is used because the time circle is exceeded. Astronomically seen, it is the case that the end of the astronomical twilight is at 23:57 o'clock local time on 8th May, no end of astronomical twilight happens on 9th May because the center of the Sun's disk is always above 18 degrees (the reference altitude of the astronomical twilight) below a geometric horizon, but on 10th May at 00:01 o'clock local time, this reference altitude is passed again. Thus, the time that is detected for the 9th May has properly to be moved to the 10th May, et cetera, as it is expressed by the output that is created by using the --limit option.
See Sun data,
for further information.
If values for the time interval are given to both above mentioned options that fall short of 0 o'clock, these values are automatically set to 0 o'clock. If values for the time interval are given that exceed 23:39 o'clock, these values are automatically set to 23:59 o'clock.
The timestep value between the starting and the ending time of the time interval that is respected by Gcal is one minute by default. This value can at pleasure be changed by using the --cycle-step option. See Fixed date option --cycle-step=argument, for more details.
You should always keep in mind that the use of the cycle mode is efficient only if the current time of the time interval is also part of that resource file line that has to be evaluated in this manner. Otherwise, it is difficult to find out unobjectionably lateron when displaying the data and times, which Sun or Moon oriented value resulted in what time.
The following example shows how the topocentric elevation angle of the Sun for the location Münster, Germany, is calculated during two days in April 2000, and that for the time interval 12:00 o'clock until 12:05 o'clock local time in each case:
| $ gcal %20000420 -Hno -f/dev/null -xdt -g::: \ > --here='0*d1#999_%ot+00+000_:_%oa+5158+00738,120' \ > --cycle-end=12:05 --time=12:00 -| -| Thu, Apr 20th 2000: +12h00': +045d58' -| Thu, Apr 20th 2000: +12h01': +046d03' -| Thu, Apr 20th 2000: +12h02': +046d07' -| Thu, Apr 20th 2000: +12h03': +046d12' -| Thu, Apr 20th 2000: +12h04': +046d17' -| Thu, Apr 20th 2000: +12h05': +046d22' -| ::: -| Fri, Apr 21st 2000: +12h00': +046d18' -| Fri, Apr 21st 2000: +12h01': +046d23' -| Fri, Apr 21st 2000: +12h02': +046d28' -| Fri, Apr 21st 2000: +12h03': +046d32' -| Fri, Apr 21st 2000: +12h04': +046d37' -| Fri, Apr 21st 2000: +12h05': +046d42' |
The timestep value between the starting and the ending time of the time interval that is respected by Gcal is one minute by default.
The following example shows how the topocentric elevation angle of the Sun for the location Münster, Germany, is calculated during two days in April 2000, and that for the time interval 10:00 o'clock until 17:00 o'clock local time with a timestep value of one hour and 15 minutes in each case:
| $ gcal %20000420 -Hno -f/dev/null -xdt -g::: \ > --here='0*d1#999_%ot+00+000_:_%o*a+5158+00738,120' \ > --cycle-end=10:00 --time=17:00 --cycle-step=1:15 -| -| Thu, Apr 20th 2000: +10h45': +38.038 -| Thu, Apr 20th 2000: +12h00': +45.962 -| Thu, Apr 20th 2000: +13h15': +49.665 -| Thu, Apr 20th 2000: +14h30': +47.882 -| Thu, Apr 20th 2000: +15h45': +41.267 -| Thu, Apr 20th 2000: +17h00': +31.633 -| ::: -| Fri, Apr 21st 2000: +10h45': +38.355 -| Fri, Apr 21st 2000: +12h00': +46.299 -| Fri, Apr 21st 2000: +13h15': +50.006 -| Fri, Apr 21st 2000: +14h30': +48.198 -| Fri, Apr 21st 2000: +15h45': +41.545 -| Fri, Apr 21st 2000: +17h00': +31.881 |
See Sun data,
and
Moon data,
likewise
Geographical distance and course angle,
for further information.
%![argument]
special texts are executed, and not displayed textually only.
See Shell command %![argument] special text,
for more details. And causes on the other hand, that
‘tvar?[command]’ and
‘tvar:[command]’ text variable definitions
is assigned the output of an external command, and not the text which
contains the call of the external command.
See Text variables,
for further information.
%? special texts.
The argument consists of one or more characters as used in the exclusion
without any argument %? special text; but without the leading
‘%’ character in each case.
For example, it is possible to induce Gcal to display only those fixed dates from the resource file demo.rc for the whole year which are legals holidays, and moreover, Saturdays or Sundays:
gcal -f demo.rc --year --filter-day=Rv
%?[date] special texts.
The argument consists of one or more expressions as used in the
exclusion with date argument %?[date] special
text; but without the leading ‘%’ character in each case. You can
use more than one of these %?[date] expressions
by connecting them with a ‘,’ character.
For example, it is possible to induce Gcal to display only those fixed dates from the resource file demo.rc for the whole year which appear within the period of the 17th and the 20th of any month, and which appear on the 31st of any month.
gcal -f demo.rc -y -P i00000017#00000020,i00000031#00000031
%?... special texts for text replacement.
The pattern is a regular expression,
as recognized by the Unix ed line-editor.
See Regular Expressions,
for further information.
For example, it is possible to induce Gcal to display all fixed dates from the resource file doctor.rc for the current month, which are defined for dentists or oculists:
gcal -f doctor.rc --month -I "[dD]entist|[oO]culist"
Each time a ‘_’ (underscore) character is found in the pattern argument, this character is replaced by a real ‘ ’ (space) character.
You may depreciate the special meaning of the ‘_’ (underscore) character
—in case this character itself is needed— by placing a ‘\’
(backslash) character before it, e.g. ‘\_’. If you need the ‘\_’
characters themselves, you have to protect the ‘\’ (backslash) character
by another ‘\’ (backslash) character, e.g. ‘\\_’.
You can use more than one resource file name by connecting them with a ‘+’ character, e.g.:
--resource-file=./foo+xyz+/data/bar+$HOME/.gcalrc resp.,
-f ./foo+xyz+/data/bar+$HOME/.gcalrc
respects all files given in the preceding argument by using a special file search mechanism. See File searching mechanism, for more details. Use /dev/null to avoid the use of the standard resource file, useful for creating empty fixed date lists. If a single ‘-’ character is given as file name, like --resource-file=./foo+-+xyz or -F-, but not -F -, Gcal reads and processes all input received from the standard input channel.
You may depreciate the special meaning of the ‘+’ separator character —in case this character itself is needed— by placing a ‘\’ (backslash) character before it, e.g. ‘\+’. If you need the ‘\+’ characters themselves, you have to protect the ‘\’ (backslash) character by another ‘\’ (backslash) character, e.g. ‘\\+’.
Each time a ‘_’ (underscore) character is found in name, this character is replaced by a real ‘ ’ (space) character.
You may depreciate the special meaning of the ‘_’ (underscore) character
—in case this character itself is needed— by placing a ‘\’
(backslash) character before it, e.g. ‘\_’. If you need the ‘\_’
characters themselves, you have to protect the ‘\’ (backslash) character
by another ‘\’ (backslash) character, e.g. ‘\\_’.
For example, the call:
gcal -# "0*d1su#99su.7 ^%Z" --here="#include <foo>" -y
causes the implicit processing of the standard resource file just before the further resource file line ‘0*d1su#99su.7 ^%Z’ and following ‘#include <foo>’ are processed, and that as if these lines were a physical part of the standard resource file.
Each time a ‘_’ (underscore) character is found in line, this character is replaced by a real ‘ ’ (space) character.
You may depreciate the special meaning of the ‘_’ (underscore) character —in case this character itself is needed— by placing a ‘\’ (backslash) character before it, e.g. ‘\_’. If you need the ‘\_’ characters themselves, you have to protect the ‘\’ (backslash) character by another ‘\’ (backslash) character, e.g. ‘\\_’.
Please note:
If the short-style option -c and/or its modifiers
t|[w|m|y[+|-], or the short-style option
-f is/are given in upper-case, e.g.:
-C
-F foo.bar
-CeT
-c-aW+
-CeaxY-
-c-M
Gcal displays fixed date messages for every day of the requested period.
The modifiers of a combined/complex/packed short-style fixed date option must be constructed according to following steps, because Gcal treats them as positional parameters:
- First step: Representation-of-text-modifier
- a, A, e|E, J, k, o, Q, U, x, z, Z
- Second step: Period-of-fixed-dates-modifier
- d, l, t|T, w|W|m|M|y|Y[+|-], n+|-, nd, nw, *dn[www], *wn[www], @e|t|dvar[[+|-]n], @e|t|dvar[+|-]nwww, mmdd, mmwwwn
If you want to operate with the preceding modifiers, an explicit -c|C[-] short-style option must be leading on the one hand, e.g.:
-c-t
-cw-
-CZdekloQUzJaxA12+
and only one period defining fixed date period modifier may be given26.
Or on the other hand, the modifiers must be given as single character options or composed into a single command line word, and additionally either the short-style option -c|C[-], -f|F name[+...] or -# line27 must be given like:
-c -t
-w- -c
-a -Ad -e -kloQUxz -C12+
-F foo.bar -dJZA -l*d10
--here="; Comment" -dZAa
If the modifiers are given as single character options or composed into a single command line word, and one of the t|T|[w|W|m|M|y|Y[+|-]] modifiers is used28, it is unnecessary to give a -c|C[-] respectively -f|F name[+...] short-style option29 to activate the fixed date function of Gcal, because it is triggered implicitly by means of these modifiers / alias names.
See Coding Scheme, whose tables explain the relations between the date part (yyyy...) of a resource file line and the modifiers, the short-style option -c|C[] —which is used for enabling the fixed date feature— respectively the long-style option --period-of-fixed-dates=argument may have, i.e. they point out all possible correspondences. This is necessary because Gcal does not respect all entries found in a resource file if a fixed date argument is given, it respects only those entries which have a definite relation to the fixed date argument to avoid the output of redundant information!
Fixed date text modifiers and options:
%;[date] special text— is
changed to number characters for each axis of the bar. The number
argument must be an integer value between 1...100, the default number
of characters is 20. If the number divides 100 with a remainder, it is
internally reduced to the nearest number that divides 100 without any
remainder. This means, only the numbers 1, 2, 4, 5, 10, 20, 25, 50 and
100 are factually respected, so a number argument of 19 is internally
reduced to 10.
For example:
| $ cat bio.rc -| 0*d1#999 %;19620921 $ gcal -fbio.rc %19961212 -s0 -xw --biorhythm-axis=19 -| -| Thu, Dec <12th>1996: 0- I P1 E +0 -| Fri, Dec 13th 1996: 0- I P 1 +0 -| Sat, Dec 14th 1996: 0- @ E 0 +0 -| Sun, Dec 15th 1996: 0- P IE 0 +0 -| Mon, Dec 16th 1996: 0- P E I 0 +0 -| Tue, Dec 17th 1996: 1-P E I0 +0 -| Wed, Dec 18th 1996: 0- @ 1 +0 |
See Biorhythm %?[date] special texts,
for more details.
%Z[date] special text— is
changed to number lines. The number argument must be an integer
value between 6...30, the default number of lines is 12.
For example:
| $ gcal -f/dev/null -#0*d1#999_%Z__%O %19950407 -x --moon=8 -| -| Fri, Apr < 7th>1995: ( @@@@@ -| ( @@@@@@@@ -| ( @@@@@@@@@@@ -| ( @@@@@@@@@@@@ -| ( @@@@@@@@@@@@ -| ( @@@@@@@@@@@ -| ( @@@@@@@@@@ -| ( @@@@@@@ 42%+ |
See Moon phase %[format]?[date] special texts,
for more details.
Mon, Jan 1st 1995: (`Eternal holiday list'#00003) New Year's day
Mon, Jan 1st 1995: (.gcalrc#00987) No fixed dates
...
Mon, Jan 1st 1995: New Year's day
Mon, Jan 1st 1995: No fixed dates
...
Gcal uses the alternative list format, e.g.:
Mon, Jan 1st 1995:
New Year's day
No fixed dates
...
| $ gcal -Cxw -cg -| -| Sun, Nov 6th 1994: Text 1 -| Sun, Nov 6th 1994: Text 2 -| -| Mon, Nov 7th 1994: Text 3 -| -| Tue, Nov 8th 1994: Text 4 ... $ gcal -Cxw -g'-A_user\_defined-~-grouping text-' -| -| Sun, Nov 6th 1994: Text 1 -| Sun, Nov 6th 1994: Text 2 -| -A user_defined- -| -grouping text- -| Mon, Nov 7th 1994: Text 3 -| -A user_defined- -| -grouping text- -| Tue, Nov 8th 1994: Text 4 ... |
The text may contain references to global date and text variables
(see Fixed date option --date-variable=argument,
and
Fixed date option --date-variable=argument).
Furthermore, all special texts which cause a text replacement may be used in
the text
(see %?... special texts for text replacement).
Each time a ‘~’ (tilde) or ‘^’ (caret) character is found in text, this character is replaced by a real ‘\n’ (newline) character.
You may depreciate the special meaning of the ‘~’ (tilde) character —in case this character itself is needed— by placing a ‘\’ (backslash) character before it, e.g. ‘\~’. If you need the ‘\~’ characters themselves, you have to protect the ‘\’ (backslash) character by another ‘\’ (backslash) character, e.g. ‘\\_’. All above mentioned facts are also valid for the ‘^’ (caret) character.
Each time a ‘_’ (underscore) character is found in text, this character is replaced by a real ‘ ’ (space) character.
You may depreciate the special meaning of the ‘_’ (underscore) character
—in case this character itself is needed— by placing a ‘\’
(backslash) character before it, e.g. ‘\_’. If you need the ‘\_’
characters themselves, you have to protect the ‘\’ (backslash) character
by another ‘\’ (backslash) character, e.g. ‘\\_’.
| $ gcal -cxo -| -| Sun, Nov 6th 1994: Text 1 -| Text 2 ... |
| $ gcal -f /dev/null -QUx %19800101 -#0_%j-2440588 -| 3652 |
| $ gcal -cxU -| -| Text 1 -| Text 2 ... |
| $ gcal -cxJ -| -| Sun, Nov 6th 1994: -| Sun, Nov 6th 1994: ... |
| $ gcal -cUJ --heading-text=Hello,_it_is_%K_,~%t__o'clock -| -| Hello, it is Sunday, -| 14:32 o'clock -| -| Sun, Nov 6th 1994: ... |
The text may contain references to global date and text variables
(see Fixed date option --date-variable=argument,
and
Fixed date option --date-variable=argument).
Furthermore, all special texts which cause a text replacement may be used in
the text
(see %?... special texts for text replacement).
Each time a ‘~’ (tilde) or ‘^’ (caret) character is found in text, this character is replaced by a real ‘\n’ (newline) character.
You may depreciate the special meaning of the ‘~’ (tilde) character —in case this character itself is needed— by placing a ‘\’ (backslash) character before it, e.g. ‘\~’. If you need the ‘\~’ characters themselves, you have to protect the ‘\’ (backslash) character by another ‘\’ (backslash) character, e.g. ‘\\_’. All above mentioned facts are also valid for the ‘^’ (caret) character.
Each time a ‘_’ (underscore) character is found in text, this character is replaced by a real ‘ ’ (space) character.
You may depreciate the special meaning of the ‘_’ (underscore) character
—in case this character itself is needed— by placing a ‘\’
(backslash) character before it, e.g. ‘\_’. If you need the ‘\_’
characters themselves, you have to protect the ‘\’ (backslash) character
by another ‘\’ (backslash) character, e.g. ‘\\_’.
Fixed date period modifiers and options:
Please note:
The following examples assumes the actual system date is the 17th February of any year (00000217), weeks start on Mondays and ISO week numbers are used!
If a @file command line argument is given, a response file by the name of file will be used, i.e. options and commands are preloaded from that file. A response file may contain options and commands —which are preloaded by Gcal—, but no references to further response files. If such references to further response files are found, they are ignored. See Global option --response-file=name, for hints how to generate a response file automatically.
The searching scheme for a response file is the same as that for resource files, except no standard response file is respected. See File searching mechanism, for more details. Multiple response files may be given in the command line when Gcal is started, and they are processed exactly in that order as given, i.e. strictly sequential.
Each option and command must be on a single line, i.e. separated by a real ‘\n’ (newline) character. A line beginning with a ‘;’ (semicolon) character in the response file is treated as a remark and will not be used by Gcal (see Comment line).
Options must be defined before commands. If a response file contains any commands, then all further arguments after the @file option of the command line are ignored.
For example:
Line Text
1 -j
2 -Cw
EOF
| $ gcal -i -b 3 @file -s 3 1994 ==> gcal -i -b 3 -j -Cw -s 3 1994 |
Line Text
1 -j
2 -Cw
3 may 1992
EOF
| $ gcal -i -b 3 @file -s 3 1994 ==> gcal -i -b 3 -j -Cw may |
Line Text
1 -j
2 -Cw
3 may
4 1992
EOF
| $ gcal -i -b 3 @file -s 3 1994 ==> gcal -i -b 3 -j -Cw may 1992 |
It is allowed to use that date —instead of the actual system date— which is defined by the %date command line argument. This means, fixed dates can be checked for any year and are respected in the same way, as if they would be fixed dates of the actual year.
The date must be denoted in one of these formats:
*d|wn[www]
@e|t|dvar[[+|-]n[www]]
Some examples to this:
Please note:
The following examples assumes the actual system date is Wednesday, the 17th February 1993 (19930217), weeks start on Mondays and ISO week numbers are used!
*d|wn[www] format:*dn)*dnwww)*dn)*dnwww)*wn)*wnwww)*wn)*wnwww)@e|t|dvar[[+|-]n[www]] format:@e)@e[+]n)@e-n)@e)@e[|]n)@e-n)@e[+]nwww)@e-nwww)@e[+]nwww)@e-nwww)@t)@t[+]n)@e-n)@t)@t[|]n)@t-n)@t[+]nwww)@t-nwww)@t[+]nwww)@t-nwww)@dvar)@dvar[+]n)@dvar-n)@dvar)@dvar[+]n)@dvar-n)@dvar[+]nwww)@dvar-nwww)@dvar[+]nwww)@dvar-nwww)The commands control the periods Gcal respects. They can be partitioned into four major classes, namely single commands, special 3-Month mode commands, lists of commands and ranges of commands. Single commands and special 3-Month mode commands only create one calendar sheet, ranges of commands or list of commands create more than one calendar sheet per program run. If a list of commands is given, Gcal works sequentially on each single command given in the list, one by one. A range of commands is expanded first by Gcal and after expansion is done, Gcal works sequentially on each single command produced during the internal expansion step.
For understanding the notation used in the text below, mm is either a number, a month name or one of the special 3-Month mode commands ., .., .+ and .-. No lists or ranges of months or years can be created in case a special 3-Month mode command is given.
The range of mm is valid from 1 to 12 or valid from January to December. Both notations may be mixed. Month names may be abbreviated up to their first three characters. yyyy is a number. The range of yyyy is valid from 1 to 9999. A range (mm-mm or yyyy+yyyy or ...) must consist of two elements. A list (mm,...,mm or yyyy;...;yyyy or ...) must contain two elements minimum and may have any number of elements.
Here is a list of all ranges of commands, lists of commands and other command separator characters:
gcal may
gcal OCTOBER
gcal ja
gcal 1992
But there is an exception of this general rule. If the specified year number is less or equal twelve, Gcal assumes that a selected month of the current year is wanted. If you want to have a selected year less or equal twelve, call Gcal like this
gcal 1:6
or like this
gcal 6+6
to obtain the year AD 6.
gcal 9 1992
gcal 9/1992
gcal Nov 1777
gcal Nov/1777
gcal :
gcal 6:
gcal feb:
gcal NOVEMBER:
gcal :1999
gcal 7:1999
gcal oct:1992
gcal February:1777
gcal .
gcal . 1992
gcal ..
gcal .. 1992
gcal .+
gcal .+ 1992
gcal .-
gcal .- 1992
gcal 1,5,12
gcal 3,1,5,3
gcal june,9,jan
gcal 1/1992,5,12/2001
gcal june/1991,9/1801,jan
gcal 3,7 1999
gcal 1,dec,july 1777
gcal 1992;1777;1899
gcal 7:1999;8:1992;April:3
Other valid lists:
gcal 6,8,3/1999,feb/3,january
gcal 3:;1994;february:1999;:1777;JAN:
gcal 3:;august:;DEC:
gcal 3-7
gcal 11-8
gcal MAY-dec
gcal 12-aug
gcal 3/1991-july/1992
gcal dec/1994-3
gcal sep-dec/2000
gcal 3-7 1999
gcal nov-3 1777
gcal aug-dec 1992
gcal 3-7 1999+2001
gcal nov-3 1777+1600
gcal aug-dec 1992+1994
gcal AUGUST 1494-1497
gcal 3/1993-1999
gcal nov/3-1777
gcal 1992+1994
gcal 7:1999+8:1992
gcal aug:1992+july:1999
The environment variable GCAL can hold a set of default options for Gcal (see Environment Variable GCAL). These options are interpreted first at program start-up, and some can be overwritten by explicit command line arguments or values found in a @file response file. See Command line arguments, and Response file, for further information.
For example:
GCAL="-i @color -b 3"; export GCAL
setenv GCAL "-i @color -b 3"
set GCAL=-i @color -b 3
On Vax/VMS, the name of the environment variable is GCAL_OPT, to avoid a conflict with the symbol GCAL set for invocation of the program.
For example:
define GCAL_OPT "-i @color -b 3"
The eternal holiday list is created only for dates after AD 29. It is assumed that the Gregorian Reformation has occurred from 10th till 22nd March 1924 for all Christian-Orthodox holidays, which are inserted into the eternal holiday list.
The eternal holiday list can be displayed in different ways:
If you start Gcal without an explicit (fiscal) date and the eternal holiday list argument (see Calendar option --holiday-list[=long|short]), e.g.:
gcal -qfr --holiday-list
gcal -qfr -n
gcal -qfr -n :
Gcal displays all holidays of the eternal holiday list that refer to the actual / fiscal year, without a leading calendar sheet.
In case you start Gcal with the eternal holiday list argument and a month (plus an additional year), e.g.:
gcal -qbe --holiday-list july
gcal -qbe -n july
gcal -qbe -n 7 1993
gcal -qbe -n 7/1993
Gcal displays a month calendar sheet of the specified month (of year), and trailing those holidays of the eternal holiday list that refer to the given month (of the given year).
If you start Gcal with the eternal holiday list argument and a simple year (or an explicit fiscal year), e.g.:
gcal -qbe --holiday-list 1993
gcal -qbe -n 1993
gcal -qbe -n july:
gcal -qbe -n :1993
gcal -qbe -n 7:1993
Gcal displays a year calendar sheet of the specified year or fiscal year, and trailing all holidays of the eternal holiday list that refer to the given year or fiscal year.
In case you start Gcal with the eternal holiday list argument and a special 3-Month mode command (see 3-Month mode commands), e.g.:
gcal -qbe --holiday-list .
gcal -qbe -n .
gcal -qbe -n ..
gcal -qbe -n .+
gcal -qbe -n .-
Gcal displays the according three months by using a fixed-style year calendar sheet, and trailing all holidays of the eternal holiday list that refer to these months.
In case you start Gcal with the eternal holiday list argument and a list or range of commands, it produces the according series of eternal holiday lists. See Lists of commands, and Ranges of commands, for further details.
Some annotations:
The following table lists all those characters which are used for marking an entry in the eternal holiday list, i.e. directly lead its date:
| Character | Description
|
|
| |
+
| Legal holiday which is valid in the whole country.
Is automatically provided with highlighting sequences respectively marking
characters.
|
#
| Legal holiday which is valid in major parts of the whole country.
Is automatically provided with highlighting sequences respectively marking
characters.
|
*
| Legal holiday which is valid in minor parts of the whole country.
Is not provided with highlighting sequences respectively marking characters.
|
-
| Other holiday which serves for memorial or remarking purposes only.
Is not provided with highlighting sequences respectively marking characters.
|
By using the --cc-holidays=cc[+...] option, it is possible to provide the eternal holiday list with additional country specific holidays. Thereafter, those country specific holidays are part of the list. See Calendar option --cc-holidays=cc[+...]. For example:
--cc-holidays=be+fr
causes the inclusion of Belgian and French holidays into the eternal holiday list. The inclusion of country specific holidays is not coupled to Gcal's internationalization (see Aspects in Internationalization). This means, no country specific holidays are automatically respected at program start-up for a definite territory or country. So it is up to the user to decide which country specific holidays are included into the eternal holiday list. See The GCAL environment variable, for information how Gcal can be induced to include the country specific holidays automatically into the eternal holiday list at program start-up.
The free selection of the different country specific holidays can be used very ingenious in case information of a definite territory or country is required. Assuming a business man from Germany proposes to travel to Italy in November and needs the information which legal holidays are celebrated there on working days so he is able to plan his dates. This can be determined as follows:
gcal -f /dev/null -q IT -D r -cE nov
This chapter describes how to use the fixed date feature of Gcal. Normally, the fixed dates are stored line by line in a so-called resource file (see Resource file). On request, Gcal searches any of such resource files for those fixed dates, that are happening in the period for which a fixed date list is wanted. If Gcal has found any fixed dates that are happening in the requested period, the program displays them collectively as a fixed date list.
Thus, each time you execute Gcal in simple single month mode, i.e. no explicit month, year or fiscal year is given in the command line, but the fixed date argument, e.g.:
gcal --list-of-fixed-dates
gcal -c
it checks the resource file for dates and processes those that refer to the actual system date (==today). Then Gcal displays all fixed dates found in the resource file which refer to the actual day (week/month/year) of the actual year, without a leading calendar sheet.
Some more examples:
gcal --ast -ce
gcal -cw-
gcal -c-m
gcal -c-y-
gcal -qbe -jcb -c-et
gcal --zod -cey-
gcal -qfr -jc -cey
The fixed date list can be embraced by different other leading and trailing output, respectively, that is also created by Gcal:
In case you start Gcal with the fixed date argument and/or a month and/or an explicit year or fiscal year; respectively with the special 3-Month mode command, e.g.:
gcal -c july
gcal -qfr -ce 7 1994
gcal -c-y 7/1994
gcal -c 7:1993
gcal -c 1993
gcal -c .
gcal -c .+
Gcal displays a (three) month / year calendar sheet of the specified respectively actual month / year, and trailing those fixed dates found in the resource file that refer to the given period; the intensity level is the same as the -cy option if the period refers to a year or fiscal year or to a three month period, respectively, is the same as the -cm option if the period refers to a month.
If you start Gcal without an explicit date and the fixed date argument in connection with the eternal holiday list argument, e.g.:
gcal -qbe -n -c
gcal -qbe -n -Cm
gcal -qbe -n -Cl1224
gcal -qbe -n -cl3+
gcal -qbe -n -4-
then Gcal displays all fixed dates found in the resource file that refer to the requested period, and after that all holidays of the eternal holiday list that refer to the whole actual year, without a leading calendar sheet. See Eternal Holidays, for more details how to use an eternal holiday list.
Annotation to previous examples:
Each time you execute Gcal in simple single year mode, i.e. no explicit month, year or fiscal year is given in the command line, but the fixed date argument (with optional modifiers) and the number of blocks argument (see Calendar option --blocks=number), e.g.:
gcal -c --blocks=3
gcal -C-em -b 3 --cc-holidays=be
gcal -c-t -b 6 -jc
it checks the resource file for dates and processes those that refer to the actual system date (==today). Gcal displays a leading year calendar sheet, and all fixed dates found in the resource file that refer to the actual day (week/month/year) of the actual year.
You can list fixed dates of past, present or future month/years, too. This can be done on the one hand, if you use the %date option in the way you require (see Actual date modifier), and on the other hand, if a command respectively a list or range of commands is used.
For example:
This section describes how to use a resource file that contains fixed dates and appointments. The name of the standard resource file is HOME/.gcalrc37.
Gcal uses a special file searching mechanism:
If the standard resource file is not found during the steps 1...4 of the file searching mechanism, no fixed date messages will be created!
In case the --debug=abort option is given and no standard resource file is found during the steps 1...4 of the file searching mechanism, the Gcal program will be aborted with an error code. See Error Code 118, and Global option --debug=abort, for more information.
If a -f|F name[+...] respectively --resource-file=name command line argument is given, a file name will be used for the resource file instead of the standard resource file. See Fixed date option --resource-file=name.
Annotation:
An extended file name contains one ore more ‘/’ (slash) characters41 and denotes a file, whose fixed access path either starts from the root file directory, like ‘/foo/bar/file’, or from the actual file directory, like ‘./bar/file’ or ‘../bar/file’. If name is an extended file name:
A simple file name denotes a file, whose access-path either does not start from the root file directory or from the actual file directory, like ‘file’ or ‘bar/file’. If name is a simple file name:
First of all, a Gcal resource file is a plain ascii text file. This text file may be created by any text editor or by redirecting the standard output channel to a file, e.g.:
| $ echo '19930217 Text'>> resource-file <RET> |
A special —but simple— line structure is required so Gcal is able to interpret its contents. Each fixed date entry in a resource file must be split into two parts, namely a date part and an optional text part which must be separated by one whitespace42 character minimum. It is unnecessary to give a whitespace separator character if no text part is specified.
A line must always end with a ‘\n’ (newline) character, except it is the
last line of a resource file. The maximum length of a line is limited to
INT_MAX43 characters. A newline character is
automatically appended to the line if the standard output channel is
directed to a file. A newline character is appended to the typed line in a
text editor window if it is completed by pressing the <RET> key. In case
the used text editor does not generate the newline character in this way, it
should be set to this mode of operation, otherwise this text editor is useless
for creating Gcal resource files.
The line structure of fixed date entries is:
date part [ whitespace text part ] newline
or more concrete, e.g.:
yyyy[mm[dd|wwwn]] [ whitespace text ] newline
or much more concrete, e.g.:
19940217 Hi, I'm the text!
Besides fixed date entries, a resource file may contain further entries like:
; A remarked line
; A formatted and multi-line \
remark
#include <file name>
#include "file name"
Date variable assignments respectively operations...
dvar=NOTHING
dvar=mmdd
dvar=mmwwwn
dvar=*dn[www]
dvar=*wn[www]
dvar=dvar[[+|-]n[www]]
dvar++
dvar--
dvar+=[+|-]n
dvar-=[+|-]n
dvar+=nwww
dvar-=nwww
Text variable assignments respectively operations...
tvar=[text] tvar?[command] tvar:[command] tvar++ tvar-- tvar+=[+|-]n tvar-=[+|-]n
tvar
Text variable references at the beginning of a Gcal resource file line may only be used if it is ensured that they are expanded to a valid Gcal resource file line.
The structure of a date part —which gives Gcal the information at which date a fixed date happens— of a line in the resource file is
either: yyyy[mm[dd|wwwn]]
- yyyy
- (4 digits), is the year including the century (range
0000...9999). Leading zeroes are required in case the defined year is less than1000and other components of the date part are trailing the year.- mm
- (2 digits or 3 characters), is the month (range
00...12or99, respectivelyJan,Feb...). A given99for the month means the last month of the year (== December). Leading zeroes are required in case the defined month is less than10and other components of the date part are trailing the month.- dd
- (2 digits), is the day (range
00...31or99). A given99for the day means the last day of the month. Leading zeroes are required in case the defined day is less than10and other components of the date part are trailing the day.- www
- (2...3 characters), is a short weekday name (range
Mon...Sun).- n
- (1 digit), is the n'th weekday www of month (range
1...5or9).
- n ==
1...5
n'th weekday www of month.- n ==
9
Last weekday www of month.
or: yyyy*d|wn[www]
- yyyy
- (4 digits), is the year including the century (range
0000...9999). Leading zeroes are required in case the defined year is less than1000and other components of the date part are trailing the year.*d- (2 characters), is the reference to an ordinary date.
*w- (2 characters), is either the reference to a date of an ISO week or the reference to a date of a standard week.
- n
- (1...3 digits), is the value in days or in weeks, the fixed date occurs. A given
99connected with a short weekday name means the last weekday www of the year. A given999connected with*dmeans the last day of a year, i.e. the 31st December. If the computed date does not occur in the year, i.e. exceeds the year bounds, the fixed date message is suppressed.- www
- (2...3 characters), is a short weekday name (range
Mon...Sun).
or: yyyy@e|t|dvar[[+|-]n]
- yyyy
- (4 digits), is the year including the century (range
0000...9999). Leading zeroes are required in case the defined year is less than1000and other components of the date part are trailing the year.@e- (2 characters), is the reference to the Easter Sunday's date.
@t- (2 characters), is the reference to today's date.
@dvar- (2 characters), is the reference to a date variable.
- [
+|-]n- (1...4 alphanumeric characters), is the optional displacement value in days, the fixed date occurs relative to the Easter Sunday's date, relative to today's date, or relative to a date variables date. A given
-999means the first day of a year, i.e. the 1st January. A given+999or999means the last day of a year, i.e. the 31st December. If the computed date does not occur in the year, i.e. exceeds the year bounds, the fixed date message is suppressed.
or: yyyy@e|t|dvar[+|-]nwww
- yyyy
- (4 digits), is the year including the century (range
0000...9999). Leading zeroes are required in case the defined year is less than1000and other components of the date part are trailing the year.@e- (2 characters), is the reference to the Easter Sunday's date.
@t- (2 characters), is the reference to today's date.
@dvar- (2 characters), is the reference to a date variable.
- [
+|-]nwww- (3...7 alphanumeric characters), is the optional displacement value in weekdays, the fixed date occurs relative to the Easter Sunday's date, relative to today's date, or relative to a date variables date. A given
-99means the first weekday www of the year. A given+99or99means the last weekday www of the year. If the computed date does not occur in the year, i.e. exceeds the year bounds, the fixed date message is suppressed.
Please note:
0000, 000, 00 or 0:00 or 0:00 or 0:Hint:
Preceding table ease misleading assumption that a fixed date, which shall
be valid for any days of the year, can be defined with a date part only
consisting of a 0. But that is only correct in that the so-defined
fixed date is respected in some few fixed date periods only
(see Coding Scheme).
If a fixed date is defined which shall be respected for any days of the
year, it must be designed with a 0*d1#999 date part. For example,
the same is likewise valid for fixed dates which represent a weekly event, and
that shall be valid during all the year. Instead of creating such a fixed date
with a 000000www date part (that is likewise respected in some
few fixed date periods only), it should be defined with a date part like
0*d1www#99www.7.
See Ranges of days,
and
Appearance factor of days,
for further information.
The date part —which is leading a fixed date text of a Gcal resource file line— may be provided with further attributes, that are either specifications of lists of days or ranges of days, which provide the information at which date a fixed date happens. More further attributes are the repetition factor as well as the appearance factor.
All of those date parts in a Gcal resource file line, which are structured as follows, may generally be provided with further attributes:
*d|w...
@e|t|dvar...
Attention:
If the date part is supplied with further attributes and the year of the fixed
date is not given in a concrete manner, i.e. the year yyyy is set to
zero, such kinds of fixed dates are only computed correctly in simple
year bounds —which means during a current year— and not in fixed dates
shown after the current year has changed, e.g. in fiscal years.
A list of days is used to define recurrent fixed dates and to use only one line in the resource file for them, instead of using several lines in a resource file needed for defining these recurrent fixed dates separately.
A list of days is specified by a ‘,’ separator character; it must contain two elements minimum and may have any number of elements. A single element of the list may not be set to a zero value and be not concrete therefore. (This would not make any sense in this context.)
Assuming a fixed date shall always occur on the 1st and the 15th day in every month of the year 1996, e.g. ‘Tax returns’, one solution would be on the one hand a fixed date entry in the resource file for the 1st of the month and another entry for the 15th of the month, which would be a total of two entries in the resource file for such a fixed date.
On the other hand, this expense can be reduced to a total of only one entry in the resource file by using a list of days, which is likewise valid for the 1st and the 15th day in every month, that is
19960001,15 Tax returns
The use of lists of days in the date part is permitted as follows:
,[mm]dd|[mm]www|[mm]wwwn ...
*d|wn|nwww,n|nwww ...
@e|t|dvar,|[+|-]n[www],[+|-]n[www] ...
000001fr3,12,99,mon,apr14,993,julfri3,08fr199600mon,fr,120*d1,1fr,999,17mo1996*w1fr,1,17mo,99fr0@a,+1,-3,5,+4fr,2fr,-10sa1996@e+1,-3,5,+4fr,2fr,-10sa1996@t+1,-3,5,+4fr,2fr,-10saA range of days just as a list of days is used to define recurrent fixed dates and to use only one line in the resource file for them, instead of using several lines in a resource file needed for defining these recurrent fixed dates separately.
A range of days is specified by a ‘#’ separator character and must consist of two elements, namely the starting day and the final day. The starting day and likewise the final day of the range may not be set to a zero value and be not concrete therefore. (This would not make any sense in this context.)
Assuming a fixed date shall always occur during the 1st and the 15th day (inclusive) in every month of the year 1996, e.g. ‘Inside work’, one solution would be on the one hand a fixed date entry in the resource file for the 1st of the month, another one for the 2nd of the month until the 15th of the month, which would be a total of 15 entries in the resource file for such a fixed date44.
On the other hand, this expense can be reduced to a total of only one entry in the resource file by using a range of days, which is likewise valid for the 1st until the 15th day in every month, that is
19960001#15 Inside work
The use of ranges of days in the date part is permitted as follows:
#www
#[mm]dd|[mm]wwwn
*d|wn[www]#n[www]
@e|t|dvar[[+|-]n[www]]#[+|-]n[www]
Preceding table shows that the starting and ending day can only be specified by using date formats of the same type left and right the ‘#’ separator character. Thus, it is not explicitly possible to define a range of days by using different types of date formats, means, fixed date entries like:
1996@e+3fr#1012 In the year 1996: every day that appears within the\
period of the date 3 Fridays after Easter Sunday's\
date until the 12th October.
cannot be defined like this. But this problem can be solved by using an
inclusive date period %i[date][#[date]]
special text for defining the ending day of the range45, and the fixed dates are simply produced until the last day of
the year, e.g.:
1996@e+3fr#+999 In the year 1996: every day that appears within the\
period of the date 3 Fridays after Easter Sunday's\
date until the 12th October.%i0#19961012
See Inclusive date period %i[date][#[date]] special text,
for more details.
199600mon#fr000000fr#mon000001fr3#1200000112#fr300000112#augfri30000sep13#99fr90*d1#1fr0*d99fr#3331996*w1fr#17mo0@a#+4fr1996@e-3#+9fr1996@t-3#+99frA repetition factor of days is used to define recurrent fixed dates and to use only one line in the resource file for them, instead of using several lines in a resource file needed for defining these recurrent fixed dates separately.
A repetition factor of days (‘:n’) is specified by a ‘:’ character and must trail the day field —which must have a concrete value in a date part of a Gcal resource file and has not been set to a zero value— respectively either lead or trail an appearance factor of days. Except ranges of days or fixed dates which occur only on a definite weekday like ‘199600mon Every Monday 1996’, such a repetition factor may be specified in all possible codings of date parts of a Gcal resource file.
This factor may have values in range 1...999. Values
greater than the real difference between the date of the first occurrence of
the fixed date and the last day of the year are always reduced to this real
difference. In this sense, any value greater 36546 means a repetition factor until the last day of
the year.
Assuming a fixed date shall always occur on the 15th day in every month of the year 1996 and covers a period of four days (inclusive the 15th itself), e.g. ‘Co-workers training’, one solution would be on the one hand a fixed date entry in the resource file for the 15th of the month and the succeeding three days, which would be a total of four entries in the resource file for such a fixed date47.
On the other hand, this expense can be reduced to a total of only one entry in the resource file by using a repetition factor of days, which is likewise valid for the 15th and the three days which succeed the 15th in every month, namely
19960015:4 Co-workers training
The use of repetition factors of days in the date part is permitted as follows:
:n|wwwn:n
*d|wn:n|nwww:n
@e|t|dvar[[+|-]n[www]]:n
:n|wwwn:n,[mm]dd:n|[mm]wwwn:n ...
*d|wn:n|nwww:n,n:n|nwww:n ...
@e|t|dvar:n,|[+|-]n[www]:n,[+|-]n[www]:n ...
000001fr3:1100000112:300000112:3,fr3:50*d1:10*d1:20*d99fr:3331996*w1fr:170@a:41996@e-3:91996@t-3:9An appearance factor of days is used to define a concrete displacement of recurrent fixed dates.
An appearance factor of days (‘.n’) is specified by a ‘.’ character and must trail the day field —which must have a concrete value in a date part of a Gcal resource file and has not been set to a zero value— respectively either lead or trail a repetition factor of days. Except fixed dates which occur only on a definite weekday and are not specified by using a range of days, like ‘199600mon Every Monday 1996’, such an appearance factor may be specified in all possible codings of date parts of a Gcal resource file. This factor may be specified with each single element of lists of days, but in a range of days, this factor may trail only the final day of the range. Well, the use of such an appearance factor is only helpful if it is either given in a range of days, or if it is given together with a repetition factor.
This factor may have values in range 1...999. Fixed dates
will be ignored if the factor takes values greater than the real difference
between the date of the occurrence of the fixed date and the last day of the
year, respectively the end of the period, for which the fixed dates shall
either be produced or respected.
Assuming a fixed date shall always occur on the 15th day in every month of the year 1996 and covers a period of seven days (inclusive the 15th itself), but shall only be respected every third day (i.e. two days have to be skipped at a time) within this period, e.g. ‘Training-college’, one solution would be on the one hand a fixed date entry in the resource file for the 15th of the month, for the 18th and for the 21st of the month, which would be a total of three entries in the resource file for such a fixed date48.
On the other hand, this expense can be reduced to a total of only one entry in the resource file by using an appearance factor of days, which is likewise valid for the 15th, the 18th and the 21st in every month, namely on the one hand by the use of a repetition factor
19960015:7.3 Training-college
or on the other hand by the use of a range of days
19960015#21.3 Training-college
The use of appearance factors of days in the date part is permitted as follows:
:n.n|dd.n:n
:n.n|wwwn.n:n
*d|wn:n.n|n.n:n
*d|wnwww:n.n|nwww.n:n
@e|t|dvar[[+|-]n[www]]:n.n
@e|t|dvar[[+|-]n[www]].n:n
:n.n|wwwn:n.n,[mm]dd:n.n|[mm]wwwn:n.n ...
.n:n|wwwn.n:n,[mm]dd:n.n|[mm]wwwn.n:n ...
*d|wn:n.n|nwww:n.n,n:n.n|nwww:n.n ...
*d|wn.n:n|nwww.n:n,n.n:n|nwww.n:n ...
@e|t|dvar:n.n,|[+|-]n[www]:n.n,[+|-]n[www]:n.n ...
@e|t|dvar.n:n,|[+|.]n[www].n:n,[+|.]n[www].n:n ...
#www.n
#[mm]dd|[mm]wwwn.n
*d|wn[www]#n[www].n
@e|t|dvar[[+|-]n[www]]#[+|-]n[www].n
000001fr3:11.300000112:3.200000112:3.2,fr3:5.30*d1:10.10*d1:2.50*d99fr:333.611996*w1fr:17.80@a:4.31996@e-3:9.41996@e3#-20sun.151996@t3#-20sun.15The text part of a line in a resource file can be any text you like. Indeed, some characters have a special meaning (‘%’, ‘$’, ‘~’, ‘^’ and ‘\’) and must be protected should the occasion arise that special character combinations are formed with them49 which might be used only textually. If the text part contains characters that are used for highlighting the text or format it for a printer, or characters with decimal values above 127 in the code table of the used character set50 not produced by Gcal itself, such characters respectively sequences are displayed by Gcal in an uninterpreted manner! For that very reason, it can happen that the output of such characters can potentially create problems with the used screen device driver software and/or the external pager program, likewise mailing of such texts by means of electronic mail.
So-called NUL characters51 may also occur in the text
part, but they only cause the suppression of all succeeding characters in the
line. In my opinion, it makes no perceptible sense to output these NUL
characters uninterpreted, so they are used for remarking purposes only;
besides, the NUL characters would lead to the same problems as already
mentioned above.
A line of the resource file is continued on the next line if a ‘\-\n’ (backslash-newline) character sequence is found, e.g.:
The line:
000000Mo Every Monday
and the lines:
000000Mo \
Every \
Monday
produce the same output and are essentially equivalent.
Furthermore, you can break-up the text of a long text part at any place you like. The term long means in this context, that the text displayed by Gcal would override the right text margin of the screen respectively break-up at that margin.
Each time a ‘~’ (tilde) character is found in the text part, this character is replaced by a real ‘\n’ (newline) character. Such texts will be displayed by Gcal in a formatted manner at a left margin, this means, they are lead by a definite number of space characters.
You may depreciate the special meaning of the ‘~’ (tilde) character —in case this character itself is needed— by placing a ‘\’ (backslash) character before it, e.g. ‘\~’. If you need the ‘\~’ characters themselves, you have to protect the ‘\’ (backslash) character by another ‘\’ (backslash) character, e.g. ‘\\~’.
Each time a ‘^’ (caret) character is found in the text part, this character is also replaced by a real ‘\n’ (newline) character. Such texts will be displayed by Gcal at column 1, this means, they are not lead by space characters. The rules for protecting the ‘^’ character are the same as the rules used for protecting the ‘~’ character.
The resource file lbrk-1.rc
| $ cat lbrk-1.rc -| ; Hi, I'm `lbrk-1.rc' and alive now -| ; -| 0 I know I'm a short text -| 0 I hope I'm long enough~here, a line break-up~\ -| and again~and now for the last time... -| 0 I hope I'm also long enough^here, a line break-up\ -| ~and again^and now for the last time... -| 0 Am I another short text? Dunno... |
is displayed as follows:
| $ gcal %00000101 --resource-file=./lbrk-1.rc --disable-highlighting -| -| Fixed date list: -| -| Sat, Jan 1st 2000: Am I another short text? Dunno... -| Sat, Jan 1st 2000: I hope I'm also long enough -| here, a line break-up -| and again -| and now for the last time... -| Sat, Jan 1st 2000: I hope I'm long enough -| here, a line break-up -| and again -| and now for the last time... -| Sat, Jan 1st 2000: I know I'm a short text |
Because whitespace characters are used to separate the date part from the text part52, it is not possible to supply the text part with leading whitespace characters without further ado. If one or more whitespace characters shall lead the text part, this can be arranged by protecting the first of these whitespace characters (and that by placing a ‘\’ (backslash) character before it), e.g. ‘\ ’ if it is a space character. By means of such a character sequence, Gcal notices that the text trailing the ‘\’ character is no longer used for separating purposes, but is member of the text part. Gcal skips this specific, marking backslash character (avoids its output) and processes the rest of the line as usual.
The following example should be enough to elucidate the above facts. The resource file wspc-1.rc
| $ cat wspc-1.rc -| 0 BANG BANG -| 0 bogus -| 0 bogomips -| 0 \hello world -| 0 \ main(){for(;;)fork();} -| 0 \ sh $0 & $0 & -| 0 \ a \ b \\ c \\\ d -| 0 What happens now?\ -| ~0 \ This! -| 0 What happens now?\\ -| ~0 \ That! |
is displayed as follows:
| $ gcal --resource-file=./wspc-1.rc --disable-highlighting -| -| Fixed date list: -| -| Wed, Jun 14th 2000: sh $0 & $0 & -| Wed, Jun 14th 2000: a \ b \\ c \\\ d -| Wed, Jun 14th 2000: main(){for(;;)fork();} -| Wed, Jun 14th 2000: BANG BANG -| Wed, Jun 14th 2000: What happens now?~0 \ That! -| Wed, Jun 14th 2000: What happens now? -| 0 \ This! -| Wed, Jun 14th 2000: \hello world -| Wed, Jun 14th 2000: bogomips -| Wed, Jun 14th 2000: bogus |
%?... Special TextsThe text part of a resource file line may be provided with different special texts which may occur in any53 number and order. All these texts start with a ‘%’ (percent) character which may be protected by a leading ‘\’ (backslash) character if the ‘%’ (percent) character itself is wanted to be used in the text part, e.g. ‘\%’. The ‘%’ character is mostly trailed by an optional format instruction, (see Format Instruction, for the detailed description of the format instruction and its components), and then trailed by a distinguishing mark —which defines the kind of the special text to be used— and if it is a letter, Gcal accepts it case-sensitive.
The purpose of these special texts is mainly to suppress output of fixed
dates in definite cases, either, or to provide them with particular texts
respectively to start external commands.
See Description of all %?... Special Texts,
for a complete description of all usable special texts, and
Summary of all %?... Special Texts,
for an according short-list of them.
For example, the resource file speci-1.rc
| $ cat speci-1.rc -| ; I'm veracious very special :) -| ; -| 0 1. Today is %>1u*K , %>02&*D %U %Y ! -| 0 2. It's the %>03&*N day of the year. -| 0 3. The actual week number is: %k . -| 0 4. Currently, it's %t* o'clock, Mr. %-USER . -| 0 5. Hurry up with your work~\ -| by reason sunrise is at %o+5158+00738+61,2: . |
is displayed as follows (in case today's date is the 4th October 1996):
| $ gcal --resource-file=speci-1.rc -H no -ox -| -| Mon, Oct 4th 1999: 1. Today is MONDAY, 04th October 1999! -| 2. It's the 277th day of the year. -| 3. The actual week number is: 40. -| 4. Currently, it's 06:53pm o'clock, Mr. esken. -| 5. Hurry up with your work -| by reason sunrise is at 07:33. |
A line54 beginning with a ‘;’
(semicolon) character in the resource file is treated as a remark and
will not be used by Gcal! Any whitespace characters may lead
the remark character.
See Text part of a line,
for information how a NUL character can be used for remarking
purposes in a text part.
The following example of the remark.rc resource file —which only consists of remarks— should be enough to elucidate the above facts:
| $ cat remark.rc -| ;00001031 ^\ -| .......^\ -| ;::;::,^\ -| ;::;::;,^\ -| ;;::;;:;;,^\ -| .vmnv\%vnv\%,.;;;:::;;:;;, .,vnmv\%vnn,^\ -| vmmmn\%vmmnv\%vnmmnv\%;;;;;;\%nmmmnv\%vnmv\%vmmv^\ -| vmmnv\%vmmmnv\%vnmmmmmnv\%;:\%nmmmmmmnv\%vnm\%vnmmmv^\ -| vmmnv\%vmmmnv\%vnmmmmmmmmnv\%nmmmmmmmmnv\%vnmm\%vnmmmv^\ -| vmmnv\%vmmmnv\%vnmmmmmmmmnv\%vmmmmmmmmmmnv\%vnmv\%vnmmmv^\ -| vmmnv\%vmmmnv\%vnmm;mmmmmmnv\%vmmmmmmmm;mmnv\%vnmv\%vnmmmv,^\ -| vmmnv\%vmmmnv\%vnmm;' mmmmmnv\%vmmmmmmm;' mmnv\%vnmv\%vnmmmv,^\ -| vmmnv\%vmmmnv\%vn;; mmmmnv\%vmmmmmm;; nv\%vnmmv\%vnmmmv^\ -| vmmnv\%vmmmmnv\%v;; mmmnv\%vmmmmm;; v\%vnmmmv\%vnmmmv^\ -| vmmnv\%vmmmmnv\%vnmmmmmmmmm;; mmmmmmmmmnv\%vnmmmmv\%vnmmmv^\ -| vmmnv\%vmmmmnv\%vnmmmmmmmmmm;; mmmmmmmmmmnv\%vnmmmmv\%vnmmmv^\ -| vmmnv\%vmmmmnv\%vnmmmmmmmmmmnv;,mmmmmmmmmmmmnv\%vn;mmmv\%vnmmmv^\ -| vmmnv\%vmmm. nv\%vnmmmmmmmmmnv\%;mmmmmmmmmmmnv\%vn; mmmv\%vnmmmv^\ -| `vmmnv\%vmm, v\%vnmmmmmmmmmmnv\%nmmmmmmmmmmnv\%v; mmv\%vnnmmv'^\ -| vmmnv\%vmm;, \%vnmmmmmmmmmnv\%nmmmmmmmmmnv\%;' mv\%vnmmmmv^\ -| vmmnv\%vmm;;, nmmm;' mmmm;;' mv\%vnmmmmv'^\ -| `vmmnv\%vmmm;;,. mmnvv;, mmv\%vnmmmmv'^\ -| `vmmnv\%vmmmmnv\%vnmmmmmmmmnvvnmmmmmmnv\%vnmmmv\%vnmmmmv'^\ -| `vmvn\%vmmmmnv\%vnmmmmmmmnvvnmmmmmnv\%vnmmmm\%vnmmmv'^\ -| `v\%mmmmmn%:\%vnmnmmmmn\%vnmmmnv%:\%vnmv\%nmv' -| -| ; A remarked line -| ; Also a remarked line -| ; A \ -| formatted and multi-line \ -| remark |
You may add #include directives in a resource file for searching and
loading further resource files55. An #include directive tells
Gcal to suspend reading the current resource file and read one other resource
file before continuing. The directive is a line in the resource file that
looks like this template:
#include whitespace argument [whitespace] newline
The argument can either be
"file name"
or56
<file name>
One whitespace character minimum is required between #include
and the argument. The argument may be trailed by extra
whitespace characters and the line must always end with a ‘\n’
(newline) character, except it is the last line of a resource file.
Let us inspect a example which is a bit more concrete:
The first #include directive tells Gcal to load the file bar
in the file directory foo from the actual file directory. If this
fails, Gcal tries to load this file by using steps 1...4 of the
previously explained mechanism used for searching files
(see File searching mechanism).
The second #include directive tells Gcal to load the file bar
from the user respectively system data file directory by using steps
3...4 of the previously explained mechanism used for searching files.
It is not allowed to include files which have a fixed access path starting
from the root file directory by such an #include directive like
‘#include </file>’ or ‘#include </foo/bar/file>’; just as
the specification of a single or an extended file name containing a disk/drive
specifier57, because the resulting
path name58 would not be a valid file name any longer.
Included files may include other files again. But the nesting level of included files is limited on the one hand by the amount of usable working storage of the computer, and on the other hand by the value which is given by the operating system respectively the compiler for the number of files which can be opened simultaneously. Recursive includes59 or cyclic includes60 are not permitted, because such backward references would produce an infinite loop in the program internally! Gcal recognizes such situations and terminates immediately with a fatal error. See Error Code 119, for more information.
If an included resource file cannot be found and no --debug=abort
option is given, processing of the resource file containing the
#include continues.
Gcal respects global and/or local date variables which may be used either in the date part of a Gcal resource file line, or which may be part of a special text in the text part of a Gcal resource file line. This means, up to 24 user-defined date variables can be set and referenced during program execution. See Fixed date option --date-variable=argument, for more information how global date variables can be used.
A date variable name dvar consists of a single, case-insensitive letter61. In a definition, this name is trailed by the assignment operator character ‘=’, and the numerical values of month mm (or a short, three characters month name, e.g. ‘Jan’, ‘Feb’...) and day dd, this variable has to store62, e.g.:
a=1127
c=a
stores the 27th November into the local date variable a and into the local date variable c. You should always remember that date variables can only be referenced in a line if they are already defined, because Gcal processes a resource file line by line.
Only local date variables can store dynamical dates given in the
mmwwwn,
dvar[+|-]n[www] or
*d|wn[www] format, e.g.:
a=03su2
b=JunMon9
c=b-3
d=c+4Sa
x=*d10
y=*d10fri
z=*w3Su
which means, date variable a stores the date of second Sunday in March and b stores date of last Monday in June. The date variable c stores the date which is three days before the date of the last Monday in June and this date is set in the date variable d to that date which is four Saturdays after the date of c. The date variable x stores the date of the 10th absolute day of the year (== 10th January). y stores the date of the 10th Friday of the year, and the assignment to z is the date of the Sunday which occurs in the 3rd week of the year.
Caution:
These kinds of assignments to date variables are only computed
correctly in simple year bounds —which means during a current year—
and not in fixed dates shown after the current year has changed,
e.g. in fiscal years.
Date variables which are defined in a resource file are always local and only respected in this specific file, and that file which is included by it. This means for the included file, that all local variables of the caller are visible. The included file itself may define its own local variables in its own name-space, which are not exported to caller on return. All other definitions of date variables63 are always global. If a resource file line contains a reference to a date variable which is not locally defined in that file, Gcal will try to use the global values held by this variable. If this fails because no global definition of this date variable is given, Gcal will not process this line. If the simple --debug respectively --debug=internal option is given, informational messages for each undefined date variable will be shown on the standard error channel (see Global option --debug=internal). If the --debug=abort option is given, the Gcal program will be aborted with an error code when the first undefined global date variable reference occurs. See Error Code 113, and Global option --debug=abort, for further information.
A local date variable can be deleted. This means, that this date variable is no longer valid in its local scope and be undefined therefore. So it is possible to use its potentially defined global value in succeeding lines if this date variable is referenced there. The following example of the resource file dvar-1.rc elucidates these facts:
| $ cat dvar-1.rc -| ; dvar-1.rc -| ; -| z=0202 -| 0@z The local assigned date to `z' -| z= -| 0@z The global assigned date to `z' -| z=0404 -| 0@z The local assigned date to `z' |
So Gcal creates the following output:
| $ gcal %1777 -H no -x -v z=1212 -f ./dvar-1.rc -y -| -| Sun, Feb 2nd 1777: The local assigned date to `z' -| Fri, Apr 4th 1777: The local assigned date to `z' -| Fri, Dec 12th 1777: The global assigned date to `z' $ gcal %1777 -H no -x -f ./dvar-1.rc -y -| -| Sun, Feb 2nd 1777: The local assigned date to `z' -| Fri, Apr 4th 1777: The local assigned date to `z' |
Only advanced users should apply the --export-date-variables option which causes that the actual incarnation of a local date variable —which was previously defined in a resource file and not in an included file— is being exported to further resource files instead of using its global value, in case that date variable is not locally defined in that further resource file. See Include directives, for more details.
But be aware, the use of this option could create unwanted results, because the order of processing the resource files is an important entity in managing the --export-date-variables option, so it is not recommended to use it. You, the user, must exactly know what you are doing when applying this option; you are expressively warned now!
Some basic operations can be performed on date variables. These are:
The scope of the operations which are done on a local date variable, is that resource or include file, where the local date variable is defined.
If operations on a global date variable are performed in a resource file or that file which is included by it, these operations are only valid in that specific file64, not in further resource files processed. This means, the initial values of global date variables are always restored if the resource file changes.
Please finally note, that each date variable assignment/operation must be given separately on a single line in the resource file.
Gcal respects global and/or local text variables which may be used anywhere in a line of a Gcal resource file. This means, up to 26 user-defined text variables can be set and referenced during program execution. See Fixed date option --text-variable=argument, for more information how global text variables can be used.
A text variable name tvar consists of the ‘$’ prefix and a single, case-insensitive letter.
A text variable is defined as follows:
Indeed, Gcal executes external commands only if the --execute-command option is given at program start-up. See Fixed date option --execute-command, for more details.
The text which appears at the right side of one of the valid assignment operator characters may reference names of already defined text variables. These references are converted to the according textual values just before the assignment is performed by Gcal. You should always remember that text variables can only be referenced in a line if they are already defined, because Gcal processes a resource file line by line. Gcal always expands text variable references recursively until all sub-references to other text variables are resolved.
Local text variables are set to an empty value and thus defined in a special mode in case no text appears at the right side of one of the valid assignment operator characters.
If a text variable is referenced, an optional format instruction may be specified between the ‘$’ prefix and the single letter (here: the variable name), which makes it possible to modify the representation of the text (here: the contents) at which the text variable points to. Let us assume a resource file by the name of tvarf-1.rc exists with the following contents:
| $ cat tvarf-1.rc -| ; tvarf-1.rc -| ; -| $a=123 -| $b=$:010*a -| $c=$b -| $b= -| 0 1. \$c=.$c. -| 0 2. \$c=.$:20*c. -| 0 3. \$b=.$>1w*b. -| 0 4. \$a=.$>5#a. |
So Gcal creates the following output:
| $ gcal -Ux --text-variable='$b=XXX YY' --resource-file=./tvarf-1.rc -| -| 1. $c=.0000000123. -| 2. $c=. 0000000123 . -| 3. $b=.Xxx Yy. -| 4. $a=. 123. |
See Format Instruction, for the detailed description of the format instruction and its components.
You may depreciate the special meaning of the ‘$’ prefix character —in case this character itself is needed in the text— by placing a ‘\’ (backslash) character before it, e.g. ‘\$’. If you need the ‘\$’ characters themselves in the text, you have to protect the ‘\’ (backslash) character by another ‘\’ (backslash) character, e.g. ‘\\$’.
External commands are not directly executed by Gcal, they are executed by means of the command line interpreter of the operating system, the shell. As consequence to this, of course the commands have to be specified according to the syntax conventions of the used shell, concerning the grouping conventions, list processing conventions, redirection conventions et cetera! For example, it is possible that you have to write ‘$a?(cat text)’ instead of the simple ‘$a?cat text’. See the pertinent literature for more details.
If the output of external commands, which appears on the standard output channel, is assigned to text variables in an interpreted manner, this output is internally directed by Gcal into a temporary file. Thereafter, the contents of the temporary file is transfered to the text variable and the temporary file is removed.
If the output of external commands, which appears on the standard
output channel, is assigned to text variables in an uninterpreted manner,
this output is internally processed by the Txt2gcal program first
(see Invoking txt2gcal),
and then this output is directed by Gcal into a temporary file. Thereafter,
the contents of the temporary file is transfered to the text variable and the
temporary file is removed. In case a TXT2GCALPROG environment variable
(see Environment Variable TXT2GCALPROG)
is defined and set with the file name of the executable Txt2gcal program,
Gcal will use this file name for calling Txt2gcal. Otherwise, the file name
txt2gcal —which is burned-in during the compilation step of the
Gcal program— is used for calling the Txt2gcal program.
The TXT2GCALPROG environment variable must always be set if the
Txt2gcal program is installed under another name than the standard name
txt2gcal, otherwise Gcal is unable to execute the Txt2gcal
program automatically!
If the simple --debug respectively --debug=internal option is given at program start-up, informational messages about the executed command and its exit code will be shown on the standard error channel (see Global option --debug=internal).
If the --debug=abort option is given, the Gcal program will be aborted with an error code in case an exit code not equal zero occurred during the execution of the command. See Error Code 2, and Global option --debug=abort, for further information.
Here is an example which explains how the output of external commands can be assigned to text variables. Supposing there is a resource file by the name of tvarc-1.rc with the following contents:
| $ cat tvarc-1.rc -| %t $a $>+06*b $>1u*c |
This file is used in the resource file tvarc-1a.rc and processed by Gcal as follows:
| $ cat tvarc-1a.rc -| ; tvarc-1a.rc -| ; -| $a=bonjour -| $b=123 -| $c=bonsoir -| $x?cat $f -| 0 \$x=---$:30*x--- -| $y:cat $f -| 0 \$y=---$y--- -| 0 \$y=:::$>1u*y::: $ gcal -f tvarc-1a.rc -QUx --exe -r'$f=./tvarc-1.rc' -| $x=--- 18:54 bonjour +00123 BONSOIR --- -| $y=---%t $a $>+06*b $>1u*c--- -| $y=:::%T $A $>+06*B $>1U*C::: |
Here are some more examples showing how Gcal processes text variables. Let us assume a resource file by the name of tvar-1.rc exists with the following contents:
| $ cat tvar-1.rc -| ; tvar-1.rc -| ; -| $a=foo -| 0 \$a:1=$a -| $c=$a -| 0 \$c=$c -| $b=$c bar $a -| 0 \$b=$b -| $a=bar $b baz $a booz -| 0 \$a:2=$a -| $a= -| $b=0 $b $c frozz $a frozz -| $b ->That's \$b -| 0 \$x='$x' and \$d is undefined: $d... -| $a= 0 ~ 1~2~\$3~%n~$c~\ -| now it's enough! -| 0 \$a=---$a--- -| $a=0 \ \ \\ And this... -| $a works too! |
So Gcal creates the following output:
| $ gcal %19960101 -H no -x -r '$A=FROBOZZ:$x=' -f ./tvar-1.rc -| -| Mon, Jan 1st 1996: \ \\ And this... works too! -| Mon, Jan 1st 1996: $a:1=foo -| Mon, Jan 1st 1996: $a:2=bar foo bar foo baz foo booz -| Mon, Jan 1st 1996: $a=--- 0 -| 1 -| 2 -| $3 -| 01-Jan-1996 -| foo -| now it's enough!--- -| Mon, Jan 1st 1996: $b=foo bar foo -| Mon, Jan 1st 1996: $c=foo -| Mon, Jan 1st 1996: $x='' and $d is undefined: $d... -| Mon, Jan 1st 1996: foo bar foo foo frozz FROBOZZ frozz ->That's $b |
Or a resource file by the name of tvar-2.rc exists with the following contents:
| $ cat tvar-2.rc -| ; tvar-2.rc -| ; -| $a=$b foo -| $b=0@e -| $a bar -| $b \$b -| 0 \$a:$a -| 0 \$b:$b |
So Gcal creates the following output:
| $ gcal %19960101 -H no -x -f ./tvar-2.rc -| -| Mon, Jan 1st 1996: $a:0@e foo -| Mon, Jan 1st 1996: $b:0@e $ gcal %19960101 -H no -x -f ./tvar-2.rc -y -| -| Sun, Apr 7th 1996: $b -| Sun, Apr 7th 1996: foo bar |
As seen before, it is allowed to store complete (or partial) date parts
(see Date part of a line),
likewise special texts
(see %?... Special Texts)
into text variables or references to other text variables,
which are processed by Gcal after their expansion.
See Description of all %?... Special Texts,
for limitations concerning the assignment of special texts to text variables.
Text variables which are defined in a resource file are always local and only respected in this specific file, and that file which is included by it. This means for the included file, that all local variables of the caller are visible. The included file itself may define its own local variables in its own name-space, which are not exported to caller on return. All other definitions of text variables65 are always global. If a resource file line contains a reference to a text variable which is not locally defined in that file, Gcal will try to use the global values held by this variable. If this fails because no global definition of this text variable is given, Gcal keeps the name of this text variable untouched in this line, except this text variable held an empty value. In such a case, Gcal completely ignores this text variable while processing and displaying instead of keeping its name untouched in this line.
An example to this. Supposing a resource file by the name of tvar-3.rc exists with the following contents:
| $ cat tvar-3.rc -| ; tvar-3.rc -| ; -| $c=+00+000 -| $h= -| $d=$c$h -| 0 %o$d %s$d -| 0 \$c=$c \$h=$h \$d=$d \$x=$x |
So Gcal creates the following output:
| $ gcal -QUx -f ./tvar-3.rc -| $c=+00+000 $h= $d=+00+000 $x=$x -| 05:57 18:04 $ gcal -QUx -r '$h=+1000:$x=' -f ./tvar-3.rc -| $c=+00+000 $h=+1000 $d=+00+000+1000 $x= -| 05:52 18:09 |
Only advanced users should apply the --export-text-variables option which causes that the actual incarnation of a local text variable —which was previously defined in a resource file and not in an included file— is being exported to further resource files instead of using its global value, in case that text variable is not locally defined in that further resource file. See Include directives, for more details.
But be aware, the use of this option could create unwanted results, because the order of processing the resource files is an important entity in managing the --export-text-variables option, so it is not recommended to use it. You, the user, must exactly know what you are doing when applying this option; you are expressively warned now!
Some basic operations can be performed on text variables in case they contain integer values. These are:
Here is an example showing how Gcal processes text variable operations. Let us assume a resource file by the name of tvaro-1.rc exists with the following contents:
| $ cat tvaro-1.rc -| ; tvaro-1.rc -| ; -| $a=130 -| $b=2 -| 0 1. \$b=$b -| $b++ -| 0 2. \$b=$b -| $b+=7 -| 0 3. \$b=$b -| $b-- -| 0 4. \$b=$b -| $b-=-5 -| 0 5. \$b=$b -| $b+=123 -| 0 6. \$b=$b -| $b-=$a -| 0 7. \$b=$b -| $b-=10000 -| 0 8. \$b=$b -| $b+=10000 -| 0 9. \$b=$b -| $b=02 -| 0 a. \$b=$b -| $b++ -| 0 b. \$b=$b |
So Gcal creates the following output:
| $ gcal -QUx -f ./tvaro-1.rc -| 1. $b=2 -| 2. $b=3 -| 3. $b=10 -| 4. $b=09 -| 5. $b=14 -| 6. $b=137 -| 7. $b=007 -| 8. $b=-9993 -| 9. $b=00007 -| a. $b=02 -| b. $b=03 |
As you can see in the former example, if operations are made like these, the default behavior of Gcal is to fill with leading zeroes to preserve a former length of a text variable, in case a carry into one of the next decimal places has happened and is taken back by an operation at a later place in the resource file. But this default behavior can be disabled respectively changed by using the already above mentioned format instruction.
The scope of the definitions which are done on a local text variable, is that resource or include file, where the local text variable is defined.
If a global text variable is redefined in a resource file or that file which is included by it, these redefinitions are only valid in that specific file66, not in further resource files processed. This means, the initial values of global text variables are always restored if the resource file changes.
Please finally note, that each text variable assignment/operation must be given separately on a single line in the resource file.
Here are some examples of problem oriented resource files which might be useful to get a deeper impression about the attributes of Gcal's fixed date feature.
Let us begin with a common example, the resource file common.rc:
| $ cat common.rc -| ; common.rc, a common example of a resource file. -| ; -| 19940715 Local time: %t --> Dentist at 10:00 -| 00000921 My %B1962 birthday%i1952#2062 -| 0000093 Gregorian~Reformation\~is %y1752 years ago -| 0000Sep03 Gregorian~Reformation\~is %y1752 years ago -| 0 Every day in every month in every year -| 0000 Every day in every month in every year -| 00000000 Every day in every month in every year -| 199400fri Every Friday in 1994 -| 000007mo3 Every third Monday~in July every year less 1980%i#1979 -| 0000@e-10 Easter Sunday-10 days every year -| 0@e-10 Easter Sunday-10 days every year -| 0000@e+10 Easter Sunday+10 days every year -| a=1127 -| 0@a+20 20 days after date of date variable `a' -| a=*W10FR -| 0@a-1 The Thursday of the 10th week every year -| 0@a The Friday of the 10th week every year -| 0@a1 The Saturday of the 10th week every year -| 1995*d10 The 10th absolute day in 1995 -| 1995*d99tue The last Tuesday in 1995 -| 0*w99su The Sunday of the last week every year -| ; -| ; Next entry is respected by ALL fixed date period modifiers. -| ; -| 1994*d1sun#99SUN.7 Each Sunday in 1994 -| ; -| ; Day of Prayer & Repentance is Wednesday before the Sunday, -| ; which is before the 1st Advent's Sunday. -| ; -| a=1225 -| a=a-5sun -| 0@a-4 Day of Prayer & Repentance -| ; or -| 0@a-1wed Day of Prayer & Repentance |
And here is a resource file by the name of demo-1.rc, used to detect all Fridays the 13th of a year:
| $ cat demo-1.rc -| ; demo-1.rc -| ; -| $a=Friday the 13th%i0000 -| $b=#0000 -| $c=fri2 -| $d=fri3 -| 00000113 $a01$c$b01$c -| 00000113 $a01$d$b01$d -| 00000213 $a02$c$b02$c -| 00000213 $a02$d$b02$d -| 00000313 $a03$c$b03$c -| 00000313 $a03$d$b03$d -| 00000413 $a04$c$b04$c -| 00000413 $a04$d$b04$d -| 00000513 $a05$c$b05$c -| 00000513 $a05$d$b05$d -| 00000613 $a06$c$b06$c -| 00000613 $a06$d$b06$d -| 00000713 $a07$c$b07$c -| 00000713 $a07$d$b07$d -| 00000813 $a08$c$b08$c -| 00000813 $a08$d$b08$d -| 00000913 $a09$c$b09$c -| 00000913 $a09$d$b09$d -| 00001013 $a10$c$b10$c -| 00001013 $a10$d$b10$d -| 00001113 $a11$c$b11$c -| 00001113 $a11$d$b11$d -| 00001213 $a12$c$b12$c -| 00001213 $a12$d$b12$d |
The result for the years 1996...2002 is as follows:
| $ gcal -H no -u -x -f ./demo-1.rc 1996+2002 -| -| Fri, Sep 13th 1996: Friday the 13th -| Fri, Dec 13th 1996: Friday the 13th -| -| Fri, Jun 13th 1997: Friday the 13th -| -| Fri, Feb 13th 1998: Friday the 13th -| Fri, Mar 13th 1998: Friday the 13th -| Fri, Nov 13th 1998: Friday the 13th -| -| Fri, Aug 13th 1999: Friday the 13th -| -| Fri, Oct 13th 2000: Friday the 13th -| -| Fri, Apr 13th 2001: Friday the 13th -| Fri, Jul 13th 2001: Friday the 13th -| -| Fri, Sep 13th 2002: Friday the 13th -| Fri, Dec 13th 2002: Friday the 13th |
Or a bit shorter version of the resource file demo-1.rc by the name of demo-2.rc, likewise used to detect all Fridays the 13th of a year, and that by using the fact, that a Friday the 13th only occurs if the first day of a month is a Sunday:
| $ cat demo-2.rc -| ; demo-2.rc -| ; -| $a=%n+12 is a Friday%i0000 -| $b=#0000 -| $c=sun1 -| 00000101 $a01$c$b01$c -| 00000201 $a02$c$b02$c -| 00000301 $a03$c$b03$c -| 00000401 $a04$c$b04$c -| 00000501 $a05$c$b05$c -| 00000601 $a06$c$b06$c -| 00000701 $a07$c$b07$c -| 00000801 $a08$c$b08$c -| 00000901 $a09$c$b09$c -| 00001001 $a10$c$b10$c -| 00001101 $a11$c$b11$c -| 00001201 $a12$c$b12$c |
The result for the years 1996...2002 is as follows:
| $ gcal -H no -u -x -f ./demo-2.rc 1996+2002 -| -| Sun, Sep 1st 1996: 13-Sep-1996 is a Friday -| Sun, Dec 1st 1996: 13-Dec-1996 is a Friday -| -| Sun, Jun 1st 1997: 13-Jun-1997 is a Friday -| -| Sun, Feb 1st 1998: 13-Feb-1998 is a Friday -| Sun, Mar 1st 1998: 13-Mar-1998 is a Friday -| Sun, Nov 1st 1998: 13-Nov-1998 is a Friday -| -| Sun, Aug 1st 1999: 13-Aug-1999 is a Friday -| -| Sun, Oct 1st 2000: 13-Oct-2000 is a Friday -| -| Sun, Apr 1st 2001: 13-Apr-2001 is a Friday -| Sun, Jul 1st 2001: 13-Jul-2001 is a Friday -| -| Sun, Sep 1st 2002: 13-Sep-2002 is a Friday -| Sun, Dec 1st 2002: 13-Dec-2002 is a Friday |
Of course, preceding textual expense for the purpose of detecting all Fridays the 13th of a year can be dramatically reduced by simply using of
0*d1fri#99fri.7 Friday the 13th%i00000013#00000013
in the resource file demo-1.rc, respectively,
0*d1sun#99sun.7 %n+12 is a Friday%i00000001#00000001
in the demo-2.rc resource file.
On the one hand, preceding one-liners reduce the coding expense quite considerably —from 28 respectively 15 lines to 1 line in each case—, but on the other hand, this partly increases the checking expense of these one-liners considerably and result in a longer program run-time therefore. Both one-liners produce about 52 internal productions respectively effective fixed date entries of themselves for each year checked by Gcal, at which the demo-1.rc and demo-2.rc resource files cause 24 respectively 12 effective fixed date entries only.
And here is a resource file by the name of demo-3.rc, used to detect all working-days of any month:
| $ cat demo-3.rc -| ; demo-3.rc -| ; -| $a=%VWork day -| $c=%i#0000$b99 -| a=$bmon1 -| 0@a#+4 $a -| a=$btue1 -| 0@a#+3 $a -| a=$bwed1 -| 0@a#+2 $a -| a=$bthu1 -| 0@a#+1 $a -| a=$bfri1 -| 0@a $a -| a=$bmon2 -| 0@a#+4 $a -| a=$bmon3 -| 0@a#+4 $a -| a=$bmon4 -| 0@a#+4 $a$c -| a=$bmon9 -| 0@a#+4 $a$c |
Respectively a bit shorter version of the resource file demo-3.rc:
; demo-3.rc
;
$a=%VWork day
$c=%i#0000$b99
0000$bmon1:5 $a
0000$btue1:4 $a
0000$bwed1:3 $a
0000$bthu1:2 $a
0000$bfri1:1 $a
0000$bmon2:5 $a
0000$bmon3:5 $a
0000$bmon4:5 $a$c
0000$bmon9:5 $a$c
And a resource file by the name of include.rc exists which is only used to include one given resource file:
| $ cat include.rc -| #include "$f" |
Then the result for the month August 1996 is as follows:
| $ gcal -H no -u -x -r '$b=08:$f=demo-3.rc' -f ./include.rc Aug 1996 -| -| Thu, Aug 1st 1996: Work day -| Fri, Aug 2nd 1996: Work day -| Mon, Aug 5th 1996: Work day -| Tue, Aug 6th 1996: Work day -| Wed, Aug 7th 1996: Work day -| Thu, Aug 8th 1996: Work day -| Fri, Aug 9th 1996: Work day -| Mon, Aug 12th 1996: Work day -| Tue, Aug 13th 1996: Work day -| Wed, Aug 14th 1996: Work day -| Thu, Aug 15th 1996: Work day -| Fri, Aug 16th 1996: Work day -| Mon, Aug 19th 1996: Work day -| Tue, Aug 20th 1996: Work day -| Wed, Aug 21st 1996: Work day -| Thu, Aug 22nd 1996: Work day -| Fri, Aug 23rd 1996: Work day -| Mon, Aug 26th 1996: Work day -| Tue, Aug 27th 1996: Work day -| Wed, Aug 28th 1996: Work day -| Thu, Aug 29th 1996: Work day -| Fri, Aug 30th 1996: Work day |
And of course, the preceding textual expense for the purpose of detecting all work days of any month can be dramatically reduced by simply using of
00000001#0099 %V%rWork day
in the resource file demo-3.rc.
And next the resource file by the name of sun-1.rc which detects the actual local time, the approximate time of sunrise and sunset, day and night length of two geographic locations:
| $ cat sun-1.rc -| ; sun-1.rc, comparison of sunrise / sunset, day length and night -| ; length of two locations, namely: Muenster.DE / Bangkok.TH -| ; All references are based on Muenster.DE ! -| ; -| ; Common definitions -| $p=0*d1#999 -| $v=%2%4 for that places local time -| $z=actual local time in -| ; Definitions for winter time -| $a=%e#1980 %e0@a#0@b-1 -| $x=Sun:~%o$c,$w rise, %s$c,$w set, %u$c,$w day, %z$c,$w night~$l -| ; Winter time in Germany == CEWT/GMT-1 (+60 minutes) -| $w=+60 -| ; Starting date of winter time in Germany -| b=10sun9 -| ; Definitions for summer time (daylight-saving time) -| $b=%e#1980 %i0@a#0@b-1 -| $y=Sun:~%o$c,$s rise, %s$c,$s set, %u$c,$s day, %z$c,$s night~$l -| ; Summer time in Germany == CEST/GMT-2 (+120 minutes) -| $s=+120 -| ; Starting date of summer time in Germany -| a=03sun9 -| ; Geographic co-ordinate and name of the location Muenster, Germany -| $c=+5158+00738+61 -| $l=%1Muenster -| ; Muenster's local time sunrise etc. for that places local time -| $p $a $x$v -| $p $b $y$v -| ; Muenster's actual local time -| 0 $a %1%@$w %2 $z $l -| 0 $b %1%@$s %2 $z $l -| ; Geographic co-ordinate and name of the location Bangkok, Thailand -| $c=+1345+10031+10 -| $l=%3Bangkok%4-time converted to $l's%2 local time -| ; Bangkok's sunrise etc. based on Muenster's local time -| $p $a $x -| $p $b $y -| ; Bangkok's local time == WAST/GMT-7 (+420 minutes) -| $t=+420 -| $w=$t -| ; Bangkok's actual local time -| $l=%3Bangkok -| 0 $a %3%@$t %4 $z $l -| 0 $b %3%@$t %4 $z $l -| ; Bangkok's sunrise etc. for that places local time -| $l=$l$v -| $p $x |
The result for the 12th September 1999 is as follows:
| $ gcal -fsun-1.rc -Ux -Hno -| -| 18:53/12-Sep-1999 actual local time in Muenster -| 23:53/12-Sep-1999 actual local time in Bangkok -| Sun: -| 01:06rise, 13:22set, 12h16'day, 11h44'night -| Bangkok-time converted to Muenster's local time -| Sun: -| 06:06rise, 18:22set, 12h16'day, 11h44'night -| Bangkok for that places local time -| Sun: -| 06:56rise, 19:54set, 12h58'day, 11h02'night -| Muenster for that places local time |
The next example is the resource file redir-1.rc which demonstrates
the use of the shell command %![argument] special text:
| $ cat redir-1.rc -| ; redir.rc, run shell command $c and redirect it to $f -| ; -| $p=0*d1#999 -| $c=$p %!$c -| $g=|txt2gcal - $p -| ; -| $c $g>$f |
The result of succeeding call of Gcal, to which you can also add the --debug=all option for a better understanding of the execution methods, is as follows:
| $ gcal --exe -QUx -f./redir-1.rc+XX -r'$f=XX:$c=echo $f' -#'0 %!rm $f' -| XX |
And finally a resource file by the name of swtim-1.rc which produces fixed date messages reminding Daylight Saving that are valid since 1981 for the Federal Republic of Germany67.
| $ cat swtim-1.rc -| ; swtim-1.rc, daylight-saving time BRD -| ; -| $a=daylight-saving time starts Sunday -| ; -| a=03sun9 -| 0@a-2#+2 Summer $a~+1 hrs. (02:00 --> 03:00 h.)%i1981 -| ; -| a=09sun9 -| 0@a-2#+2 Winter $a~-1 hrs. (03:00 --> 02:00 h.)%i1981#1995 -| ; -| a=10sun9 -| 0@a-2#+2 Winter $a~-1 hrs. (03:00 --> 02:00 h.)%i1996 |
The result for the year 1998 is as follows:
| $ gcal %1998 -Hno -xy -f ./swtim-1.rc -| -| Fri, Mar 27th 1998: Summer daylight-saving time starts Sunday -| +1 hrs. (02:00 --> 03:00 h.) -| Sat, Mar 28th 1998: Summer daylight-saving time starts Sunday -| +1 hrs. (02:00 --> 03:00 h.) -| Sun, Mar 29th 1998: Summer daylight-saving time starts Sunday -| +1 hrs. (02:00 --> 03:00 h.) -| Mon, Mar 30th 1998: Summer daylight-saving time starts Sunday -| +1 hrs. (02:00 --> 03:00 h.) -| Tue, Mar 31st 1998: Summer daylight-saving time starts Sunday -| +1 hrs. (02:00 --> 03:00 h.) -| Fri, Oct 23rd 1998: Winter daylight-saving time starts Sunday -| -1 hrs. (03:00 --> 02:00 h.) -| Sat, Oct 24th 1998: Winter daylight-saving time starts Sunday -| -1 hrs. (03:00 --> 02:00 h.) -| Sun, Oct 25th 1998: Winter daylight-saving time starts Sunday -| -1 hrs. (03:00 --> 02:00 h.) -| Mon, Oct 26th 1998: Winter daylight-saving time starts Sunday -| -1 hrs. (03:00 --> 02:00 h.) -| Tue, Oct 27th 1998: Winter daylight-saving time starts Sunday -| -1 hrs. (03:00 --> 02:00 h.) |
The nowadays calendar was first formulated in several inaccurate variations by the Romans based on methods developed by the Babylonians and Egyptians. The aim of all these calendars was to harmonize the cycles of the Moon and the Sun. During Julius Caesar's reign, January was falling in autumn so he ordered Sosigenes to make changes to the calendar. He added 90 days to the year 46 BC to make up for the seasonal drift and adjusted the lengths of the months similarly as we know them to be today. He introduced the leap year by adding one day to February every four years. For the present, the leap year regulation was made in the way that all four years after the 23rd day in February a leap day was laid in, so the 24th February occurred twice. The use of the leap year was an improvement but not entirely accurate.
But in the later years, the leap rule was used in the wrong way so that the errors are corrected by emperor Augustus in the year 8 BC. A curious sequel happened on this occasion. Because Augustus reacted with great jealousy to all things previously made and propagated by Julius Caesar, he did not like Caesar's name in the calendar, namely the today's month of July. Offhandedly he ordered to name another month to himself and so the month name August arose. Furthermore, Augustus did not tolerate the fact that his month of birth (the August) was shorter than Caesar's month in the sense of the periodical sequence of months with 30 and 31 days. Consequently, the month of August got 31 days, too. Due to this modification, the number of days in February were reduced to 28 and 29 days, respectively, so the 29th February was designed to be the leap day now.
This calendar is well known under the term Julian calendar and is based on a plain solar year. The nominal length of a solar year (respectively a so-called tropical year) is 365 days, 5 hours, 48 minutes, and 46 seconds. One 366-day year every four years equates to an average Julian year of 365 days and 6 hours, consequently to 365.25 days. This means, every four years, an error of 44 minutes, 56 seconds was accumulated by this kind of calendar calculation. Because of this counting method, the length of the years becomes a bit too long, by more than 11 minutes.
By the 16th century, the vernal equinox occurred around March 11, rather than March 21, by reason of an accumulated error of ten days. The feast of Easter shifted away more and more from the habitual vernal date, which must have always been celebrated on an earlier date. So Pope Gregory XIII introduced the new style calendar in 1582. Thursday, the 4th October 1582, was followed by Friday, the 15th October, by suppressing the ten days between both dates. Moreover, he ordained that years ending in hundreds should not be leap years unless they are divisible by 400. Incidentally, the Gregorian reform compensates by 72 hours (3 days) every 400 years. The actual excess accumulated is 74 hours, 53 minutes and 20 seconds. The error of 2 hours, 53 minutes and 20 seconds every 400 years accumulates to one day in about 3300 years. Thereby, the Gregorian year has an average length of 365.2425 days.
But this Gregorian calendar was accepted very slowly by others. Catholic countries adopted the Gregorian calendar almost immediately. Most Protestant countries on the Continent adopted the new calendar around 1700. England and the American colonies changed in 1752, by act of Parliament. Orthodox Christian countries adopted the Gregorian calendar later. Russia was the last European country to do so, after the communist revolution of 1917. As a result, the former U.S.S.R. celebrated the October Revolution (happened on October 25th, 1917) in the old style calendar on November 7th.
The era of a world wide uniform calendar is already part of history today. The Iran returned to the traditional Mohammedan lunar calendar in 1979 after removal of the Shah reign. There are some efforts to improve our currently valid Gregorian calendar. Its disadvantages are the reason why an appointed day is not always on the same week day. Besides, the month lengths are not equal and the holidays, which have relations to the feast of Easter, are moved within the calendar from one year to another. A very sophisticated suggestion was proposed by the United Nations, but the international establishment of this suggestions has failed, since it was resisted by some countries as well as the churches.
Three small utility programs are part of the Gcal 3.6 package. The Tcal program runs the Gcal program with the date set one day ahead. The Txt2gcal program creates a verbatim Gcal resource file from a text file, and in contrast to this, the Gcal2txt program creates a verbatim text file from a Gcal resource file.
The Tcal program runs the Gcal program with the date of tomorrow's day68. Its arguments are as follows:
tcal [--help | --version] | [--shift=[+|-]number] [argument...]
All given arguments are passed unmodified to the Gcal program. If the Gcal program shall be called with another date than tomorrow's date, this desired date can be selected by using the --shift=[+|-]number option, in which [+|-]number is the distance of days the desired date is distant from the actual system date (==today). (Works only for Gregorian years.) The --shift option must be given before all other arguments that are passed to the Gcal program.
In case a GCALPROG environment variable
(see Environment Variable GCALPROG)
is defined and set with the file name of the executable Gcal program,
Tcal will use this file name for calling Gcal. Otherwise, the file name
gcal —which is burned-in during the compilation step of the
Tcal program— is used for calling the Gcal program. The GCALPROG
environment variable must always be set if the Gcal program is installed
under another name than the standard name gcal, otherwise Tcal
is unable to execute the Gcal program automatically! An exit status
of 0 means all processing is successfully done, any other value means
an error has occurred.
The program accepts the following options:
The Txt2gcal program creates a verbatim Gcal resource file from a text file. Its arguments are as follows:
txt2gcal [--help | --version] | [text-file|-] [date-part]
If no text-file argument is given or/but a single ‘-’ character, the program reads and processes all input received from the standard input channel. If no date-part argument is given, Txt2gcal creates a ‘0’ for the date part. All results are always shown on the standard output channel. An exit status of 0 means all processing is successfully done, any other value means an error has occurred.
The program accepts the following options:
Here comes an example how to use Txt2gcal. Let us suppose there is a text file by the name of tdemo-1.txt with the following contents:
| $ cat tdemo-1.txt -| Hi friends, -| -| I'm the demo text containing funny characters and character -| sequences like ~~ \~ % %% $a $1 %%%\ -| %\ %s %%foo %bar \%Baz \\~ \~\ and so on... -| I'm be anxious how I'll be transformed by `txt2gcal'. -| |
and Txt2gcal processes this file, redirecting the output to tdemo-1.rc:
| $ txt2gcal tdemo-1.txt 0*d1#999 > tdemo-1.rc $ cat tdemo-1.rc -| 0*d1#999 \ Hi friends,~\ -| ~\ -| I'm the demo text containing funny characters and character~\ -| sequences like \~\~ \\~ % %% \$a $1 %%%\ ~\ -| %\ \%s %\%foo \%bar \\%Baz \\\~ \\~\ and so on...~\ -| I'm be anxious how I'll be transformed by `txt2gcal'.~\ |
then Txt2gcal has now created a new Gcal resource file tdemo-1.rc from the text file tdemo-1.txt. Let us finally see, how Gcal will interpret this new resource file:
| $ gcal %19960101 -H no -Ax -f ./tdemo-1.rc -| -| Mon, Jan 1st 1996: -| Hi friends, -| -| I'm the demo text containing funny characters and character -| sequences like ~~ \~ % %% $a $1 %%%\ -| %\ %s %%foo %bar \%Baz \\~ \~\ and so on... -| I'm be anxious how I'll be transformed by `txt2gcal'. -| |
The Gcal2txt program creates a verbatim text file from a Gcal resource file. Its arguments are as follows:
gcal2txt [--help | --version] | [resource-file|-]
If no resource-file argument is given or/but a single ‘-’ character, the program reads and processes all input received from the standard input channel. All results are always shown on the standard output channel. An exit status of 0 means all processing is successfully done, any other value means an error has occurred.
The sense and purpose of Gcal2txt is to retrieve all additional texts, which are put into the output by means of the Txt2gcal program.
The program accepts the following options:
Here comes an example how to use Gcal2txt. For that purpose, let us use the resource file tdemo-1.rc of the previous section (see Invoking txt2gcal), which was created by means of the Txt2gcal program from a text file and which looks like this:
| $ txt2gcal tdemo-1.txt 0*d1#999 > tdemo-1.rc $ cat tdemo-1.rc -| 0*d1#999 \ Hi friends,~\ -| ~\ -| I'm the demo text containing funny characters and character~\ -| sequences like \~\~ \\~ % %% \$a $1 %%%\ ~\ -| %\ \%s %\%foo \%bar \\%Baz \\\~ \\~\ and so on...~\ -| I'm be anxious how I'll be transformed by `txt2gcal'.~\ |
Now let us see, how this resource file will be processed by Gcal2txt:
| $ gcal2txt tdemo-1.rc -| Hi friends, -| -| I'm the demo text containing funny characters and character -| sequences like ~~ \~ % %% $a $1 %%%\ -| %\ %s %%foo %bar \%Baz \\~ \~\ and so on... -| I'm be anxious how I'll be transformed by `txt2gcal'. |
Starting with version 2.00, Gcal is able to display message texts using any
native languages instead of using the English language only, because parts
of the GNU gettext package are integrated into the Software.
See Introduction,
for more details.
By default, Gcal displays all message texts using the English native language in case no other native language is wanted. A so-called message catalog is read by Gcal at run-time if message texts from another native language are required. Gcal 3.6 supports the following native languages:
| Native Language | Language Code
|
|
| |
| English | en
|
| German | de
|
| French | fr
|
| Dutch | nl
|
| Polish | pl
|
| Russian | ru
|
| Swedish | sv
|
It is only necessary to set one of the environment variables69:
| 1. | LANGUAGE
|
| 2. | LC_ALL
|
| 3. | LC_MESSAGES
|
| 4. | LANG
|
with a language code to select another native language instead of the English native language.
Normally, users only have to set the LANG environment variable to tell Gcal the native language to use at run-time level. Presuming users want to run Gcal using the German native language for displaying message texts, they merely have to execute ‘setenv LANG de’ (in csh) or ‘export LANG; LANG=de’ (in sh) at the shell prompt. Of course they could even do this from their .login or .profile file. See The User's View, for more details.
As shown above, a simple setting of de in the environment variable
LANG is sufficient to enable German message texts. de is the
two-letter language code for the German language defined in the
ISO-639:1988, and is called simple language code information
in the further context. Other language codes can be taken from this
ISO-document70.
Because Gcal as calendar program must also comply the specifics of a used native language concerning the ordering of day, month and year (and further things) of a displayed date, the period of Gregorian Reformation, the type of week number and the representation of calendar sheets, these criteria are likewise bound to the language code71.
A en language code causes the following internal defaults of above
criteria:
September 1994
Su Mo Tu We Th Fr Sa
1 2 3
4 5 6 7 8 9 10
11 12 13 14 15 16 17
18 19 20 21 22 23 24
25 26 27 28 29 30
And a de language code72
causes the following internal defaults:
September 1994
Monday 5 12 19 26
Tuesday 6 13 20 27
Wednesday 7 14 21 28
Thursday 1 8 15 22 29
Friday 2 9 16 23 30
Saturday 3 10 17 24
Sunday 4 11 18 25
Remember, all these internal defaults are modifiable by the options --date-format, --gregorian-reform, --starting-day, --iso-week-number and --type.
If no language code is detected, Gcal takes the internal defaults of the
en language code73.
If a language code is specified for which no message catalog is
installed, Gcal takes the internal defaults of the de language code,
but displays the message texts using the English native language. Actually,
this behavior seems to me the most proper solution in such a case. The English
native language is spoken all over the world unlike the German or other native
languages, so it is wise to use it here. But the other criteria bound to the
English native language are so special for users of other native languages,
that it is wise to use the criteria taken for internal defaults of the
de language code, because most European countries (taken as standard)
essentially use them.
Now British users will certainly ask whether they could use their date format as an internal default74. The answer to this is a simple yes, nevertheless, these users have to set the environment variable LANG with an extended language code information instead of a simple language code information.
The usual template of an extended language code information is as follows:
language[_territory][.codeset][@modifier]
language[_territory][+audience][+special][,sponsor][_revision]
Both syntaxes contain the language and territory components,
which are used by Gcal to select the native language and the other criteria.
The language component is equivalent to the simple language code
information and the territory component is a two-letter territory or
country code as defined by the ISO-3166 like ‘GB’ for Great
Britain or ‘US’ for the U.S.A. See the pertinent literature for more
details. So British users only have to set the LANG environment
variable with a en_GB contents, and after that, they can use the
British date format as an internal default.
Within this document, the following metasyntactic conventions will be used when discussing command line options, commands, arguments and templates:
e|t|dvar$tvarNOTHING, a, b, ab, ba ...
a, b, ab, ba ...
This appendix is derived from the gawk-3.0.0 and regex-0.12
manuals.
A regular expression, or regexp, is a way of describing a set of strings. The simplest regular expression is a sequence of letters, numbers, or both. Such a regexp matches any string that contains that sequence. Thus, the regexp ‘foo’ matches any string containing ‘foo’. Other kinds of regular expressions let you specify more complicated classes of strings.
Gcal uses exactly one of the following regular expression programming libraries respectively methods, and that in the decreasing priority how it is chosen at configuration time, or better, compile time of the software:
| No. | Function | Symbol
|
|
| ||
| 1. | GNU re_compile_pattern() and regex.h
| GNU-REGEX
|
| 2. | POSIX regcomp() and regex.h
| POSIX-REGEX
|
| 3. | BSD re_comp()
| BSD-REGEX
|
| 4. | System V regcmp()
| SysV-REGEX
|
| 5. | Henry Spencer V8 regcomp() and regexp.h
| V8-REGEX
|
| 6. | Pattern matching is supported, but without metacharacters | NO-REGEX
|
Try ‘gcal --version’ for detecting the kind of regular expression programming library respectively method that is burned-in in your Gcal program!
A regular expression can be used as a pattern if Gcal's --filter-text=pattern option is specified at program start-up.
See Fixed date option --filter-text=pattern, for more details.
Then the regular expression is tested against the entire, completely expanded text of each valid fixed date, and the fixed date is only displayed in case the pattern matches the text75.
You can combine regular expressions with the following characters, called regular expression operators, or metacharacters, to increase the power and versatility of regular expressions.
Here is a table of these metacharacters. All characters that are not listed in the table stand for themselves.
\\$
matches the character ‘$’.
^^@chapter
matches the ‘@chapter’ at the beginning of a string, and can be used
to identify chapter beginnings in Texinfo source files.
The ‘^’ is known as an anchor, since it anchors the pattern to
matching only at the beginning of the string.
$p$
matches a string that ends with a ‘p’. The ‘$’ is also an anchor.
..P
matches any single character followed by a ‘P’ in a string. Using
concatenation we can make a regular expression like ‘U.A’, which
matches any three-character sequence that begins with ‘U’ and ends
with ‘A’.
[...][MVX]
matches any one of the characters ‘M’, ‘V’, or ‘X’ in a string.
Ranges of characters are indicated by using a hyphen between the beginning and ending characters, and enclosing the whole thing in brackets. For example:
[0-9]
matches any digit.
Multiple ranges are allowed. E.g., the list [A-Za-z0-9] is a
common way to express the idea of “all alphanumeric characters.”
To include one of the characters ‘\’, ‘]’, ‘-’ or ‘^’ in a character list, put a ‘\’ in front of it. For example:
[d\]]
matches either ‘d’, or ‘]’.
Character classes are a new feature introduced in the POSIX standard. A character class is a special notation for describing lists of characters that have a specific attribute, but where the actual characters themselves can vary from country to country and/or from character set to character set. For example, the notion of what is an alphabetic character differs in the U.S.A. and in France.
A character class is only valid in a regexp inside the brackets of a character list. Character classes consist of ‘[:’, a keyword denoting the class, and ‘:]’. Here are the character classes defined by the POSIX standard:
[:alnum:][:alpha:][:blank:][:cntrl:][:digit:][:graph:][:lower:][:print:][:punct:][:space:][:upper:][:xdigit:]For example, before the POSIX standard, to match alphanumeric
characters, you had to write [A-Za-z0-9]. If your
character set had other alphabetic characters in it, this would not
match them. With the POSIX character classes, you can write
[[:alnum:]], and this will match all the alphabetic
and numeric characters in your character set.
Two additional special sequences can appear in character lists. These apply to non-ascii character sets, which can have single symbols (called collating elements) that are represented with more than one character, as well as several characters that are equivalent for collating, or sorting, purposes. (E.g., in French, a plain ‘e’ and a grave-accented ‘è’ are equivalent.)
[[.ch.]] is a regexp that matches this collating element,
while [ch] is a regexp that matches either ‘c’ or ‘h’.
[[=eè=]] is a regexp that matches
either ‘e’ or ‘è’.
These features are very valuable in non-English speaking locales.
Caution:
The library functions that Gcal uses for regular expression matching
currently only recognize POSIX character classes (possibly); they do
not recognize collating symbols or equivalence classes.
[^ ...][^0-9]
matches any character that is not a digit.
|^P|[0-9]
matches any string that matches either ‘^P’ or ‘[0-9]’. This means it matches any string that starts with ‘P’ or contains a digit.
The alternation applies to the largest possible regexps on either side.
In other words, ‘|’ has the lowest precedence of all the regular
expression operators.
(...)*ph*
applies the ‘*’ symbol to the preceding ‘h’ and looks for matches of one ‘p’ followed by any number of ‘h’s. This will also match just ‘p’ if no ‘h’s are present.
The ‘*’ repeats the smallest possible preceding expression. (Use parentheses if you wish to repeat a larger expression.) It finds as many repetitions as possible. For example:
gcal --filter-text='\(c[ad][ad]*r x\)' -f sample.rc -y
prints every fixed date in sample.rc containing a fixed date text
of the form ‘(car x)’, ‘(cdr x)’, ‘(cadr x)’,
and so on. Notice the escaping of the parentheses by preceding them with
backslashes.
+wh+y
would match ‘why’ and ‘whhy’ but not ‘wy’, whereas ‘wh*y’ would match all three of these strings. This is a simpler way of writing the last ‘*’ example:
gcal --filter-text='\(c[ad]+r x\)' -f sample.rc -y
?fe?d
will match ‘fed’ and ‘fd’, but nothing else.
{n}{n,}{n,m}wh{3}ywh{3,5}ywh{2,}yGNU software that deals with regular expressions provides a number of additional regexp operators. These operators are described here.
Most of the additional operators are for dealing with word matching. For our purposes, a word is a sequence of one or more letters, digits, or underscores (‘_’).
\w[A-Za-z0-9_] or
[[:alnum:]_].
\W[^A-Za-z0-9_] or
[^[:alnum:]_].
\<\<away matches ‘away’, but not
‘stowaway’.
\>stow\> matches ‘stow’, but not ‘stowaway’.
\b\B\Brat\B matches ‘crate’, but it does not match ‘dirty rat’.
‘\B’ is essentially the opposite of ‘\b’.
There are two other operators that work on buffers. In Emacs, a buffer is, naturally, an Emacs buffer. For other programs, the regexp library routines that Gcal uses consider the entire string to be matched as the buffer80.
For Gcal, since ‘^’ and ‘$’ always work in terms of the beginning and end of strings, these operators do not add any new capabilities. They are provided for compatibility with other GNU software.
\`\'In regular expressions, the ‘*’, ‘+’, and ‘?’ operators, as well as the braces ‘{’ and ‘}’, have the highest precedence, followed by concatenation, and finally by ‘|’. As in arithmetic, parentheses can change how operators are grouped.
Case is normally significant in regular expressions, both when matching ordinary characters (i.e. not metacharacters), and inside character sets. Thus a ‘w’ in a regular expression matches only a lower-case ‘w’ and not an upper-case ‘W’.
The simplest way to do a case-independent match is to use a character list: ‘[Ww]’. However, this can be cumbersome if you need to use it often; and unfortunately, it can make the regular expressions harder to read. Supplying a want, Gcal offers the --ignore-case option which ignores all case distinctions in both the regular expression and the completely expanded text of each valid fixed date. See Fixed date option --ignore-case.
Regular expressions are based on POSIX EREs (Extended Regular Expressions). Regexps are composed of characters. Here is a short-list of them all:
\c.^$[abc...][[:keyword:]]alnum, alpha, blank,
cntrl, digit, graph, lower, print,
punct, space, upper, and xdigit.
[[.element.]][[=list=]][^abc...]|r2+*?(r){n}{n,}{n,m}\b\B\<\>\w\W\`\'%?... Special TextsThe %?... special texts which can be used in the text part
of a Gcal resource file line can coarsely be separated into three categories.
So there are special texts used for suppression output of fixed dates in
definite cases. Others are replaced by particular texts or cause the shell
to start external commands.
See %?... Special Texts,
for a general description of the special texts which may be used
in the text part of a Gcal resource file line.
Some of these special texts may have an optional format instruction (called format in the further context), which affects the representation of an expanded special text. See Format Instruction, for the detailed description of the format instruction and its components. A possibly specified format within special texts which may not have a format instruction is ignored by Gcal and not displayed in output.
But Gcal is also able to represent such special texts in a special way by using a format instruction, and that by using an indirect method. For displaying, you simply assign the special text exclusively to a text variable which contains a format instruction. Nevertheless, it is important to note that the field width component of the format instruction is chosen in the way that it refers to the assigned contents of the text variable, if the format instruction has a fixed format component. The contents assigned to the text variable is only the special text, and not its expanded result. Gcal has to proceed like that, because the special text which is hidden in the text variable could not be used (here: displayed) only for a definite date, but possibly also for several dates, and that adjusted to each date it is referenced. Thus exists a special text in the text variable which has a definite length, and a format instruction also exists, whose field width component has to affect the expanded result of the special text. Indeed, Gcal does not know at the moment when the assignment of the special text to the text variable is made, of which length the expanded result will be, because this expansion is made at a much later phase in the program execution. So, in such a case, the field width component of a format instruction should have the length of the special text minimum, otherwise it is crippled and expanded respectively displayed incorrectly by the internal methods which effect the expansion.
Of course, not all possibilities concerning the representation —which are offered by the format instruction— are listed here for those special texts those expanded representation may be affected by an optional format instruction, but only some few exemplary.
And some of these special texts may also have an optional simple or special date argument (called date in the further context) or another argument (called argument in the further context). The date argument must be given in one of the following date formats in case a special text is directly trailed by it:
*d|wn[www]
@e|t|dvar[[+|-]n[www]]
Special texts that may have a date argument must always be trailed by a whitespace character which is removed in output, no matter whether date was given or not!
See Summary of all %?... Special Texts,
for a short-list of all applicable special texts.
%?... special texts for date exclusion%?... special texts used for exclusion of points of time or
periods of dates are very useful if they are used together with ranges of days
(see Ranges of days).
The complete special text is always suppressed in output
in case the fixed date text must be displayed.
%?[date] special textsFirst of all, an inclusive date period
%?[date] special text
can be specified with the effect, that only those
fixed dates are respected and displayed which are
part of this period. And the specification of an
exclusive date period %?[date]
special text has the effect, that only those fixed dates are respected
and displayed which are not part of this period.
Cleverly combined, these special texts offer very effective filtration capabilities used for the definition of special periods in a highly flexible manner, for example:
0*d1#999 Every day of year: from January...August except April\
%i00001#00008 %e00004#00004
;
0*d1#999 Every day of year: from 1991...1993 and from 1996\
except February 1992 and all September\
%i1991#1993 %i1996# %e19922#19922 %e00009#00009
%i[date][#[date]] special text
%i[date][#[date]]
references an inclusive date period, i.e. all dates which are part of the
specified period are valid and are displayed. Of course this means, that all
fixed dates which are not part of this period (not covered by it) are invalid
and remain undisplayed therefore.
The first specified date defines the starting date of the fixed date, i.e. the first date the fixed date may occur. For the starting date, the following rules concerning definite omission values are valid, elucidated by using the yyyy[mm[dd|wwwn]] date format:
0000, the current year is assumed for the year.
01 (==January) is assumed for the
month.
00, the current month is assumed for the month,
and the December is assumed in case mm is set to 99.
01 is assumed for the day.
00, the current day is assumed for the day,
and the last day of the month mm is assumed in case dd is set to
99.
1...5 or 9),
then a www field must also be specified.
The second specified date defines the ending date of the fixed date, i.e. the last date the fixed date may occur. For the ending date, the following rules concerning definite omission values are valid, likewise elucidated by using the yyyy[mm[dd|wwwn]] date format:
0000, the current year is assumed for the year.
12 (==December) is assumed for the
month.
00, the current month is assumed for the month,
and the December is assumed in case mm is set to 99.
00, the current day is assumed for the day,
and the last day of the month mm is assumed in case dd is set to
99.
1...5 or 9),
then a www field must also be specified.
The preceding rules are analogously valid for the other permitted date formats.
If the starting date, which is encoded in the %i... special
text, is later the ending date, the %i... special text
will be ignored.
In case neither the starting date nor the ending date is specified, means only ‘%i’ is given, the implicit period 1st January 1...31st December 9999 (00010101...99991231) will be used.
If only the starting date is specified, means either ‘%idate’ or ‘%idate#’ is given, the implicit ending date 31st December 9999 (99991231) will be used.
In case only the ending date is specified, means ‘%i#date’ is given, the implicit starting date 1st January 1 (00010101) will be used.
For example:
0d*1#999 Every day of year: only April and July\
%i00004#00004 %i00007#00007
;
0*d1#999 Every day of year: from January...October\
%i#000010
;
0*d1#999 Every day of year: from August 1990\
%i19908
;
0*d1#999 Every day of year: from August...December\
%i00008
;
0*d1#999 Every day of year: only today%i0@t#0@t
%e[date][#[date]] special text
%e[date][#[date]]
references an exclusive date period, i.e. all dates which are part of the
specified period are invalid and remain undisplayed therefore. Of course
this means, that all fixed dates which are not part of this period
(not covered by it) are valid and are displayed.
The first specified date defines the starting date of the fixed date, i.e. the first date the fixed date may occur. For the starting date, the following rules concerning definite omission values are valid, elucidated by using the yyyy[mm[dd|wwwn]] date format:
0000, the current year is assumed for the year.
01 (==January) is assumed for the
month.
00, the current month is assumed for the month,
and the December is assumed in case mm is set to 99.
01 is assumed for the day.
00, the current day is assumed for the day,
and the last day of the month mm is assumed in case dd is set to
99.
1...5 or 9),
then a www field must also be specified.
The second specified date defines the ending date of the fixed date, i.e. the last date the fixed date may occur. For the ending date, the following rules concerning definite omission values are valid, likewise elucidated by using the yyyy[mm[dd|wwwn]] date format:
0000, the current year is assumed for the year.
12 (==December) is assumed for the
month.
00, the current month is assumed for the month,
and the December is assumed in case mm is set to 99.
00, the current day is assumed for the day,
and the last day of the month mm is assumed in case dd is set to
99.
1...5 or 9),
then a www field must also be specified.
The preceding rules are analogously valid for the other permitted date formats.
If the starting date, which is encoded in the %e... special
text, is later the ending date, the %e... special text
will be ignored.
In case neither the starting date nor the ending date is specified, means only ‘%e’ is given, the implicit period 1st January 1...31st December 9999 (00010101...99991231) will be used.
If only the starting date is specified, means either ‘%edate’ or ‘%edate#’ is given, the implicit ending date 31st December 9999 (99991231) will be used.
In case only the ending date is specified, means ‘%e#date’ is given, the implicit starting date 1st January 1 (00010101) will be used.
For example:
0d*1#999 Every day of year: except April and July\
%e00004#00004 %e00007#00007
;
0*d1#999 Every day of year: except January...October\
%e#000010
;
0*d1#999 Every day of year: until July 1990\
%e19908
;
0*d1#999 Every day of year: except August...December\
%e00008
;
0*d1#999 Every day of year: except today%e0@t#0@t
%? special textsFirst of all, an inclusive day period %? special text can
be specified with the effect, that only those fixed dates are respected
and displayed which are part of this period. And the specification of an
exclusive day period %? special text has the effect,
that only those fixed dates are respected and displayed which are not part
of this period.
Cleverly combined, these special texts also offer very effective filtration capabilities used for the definition of very special periods.
For example:
0*d1#999 Every day of year: all Mondays...Fridays\
except Wednesdays and all legal holidays\
%r%F%V
;
00001001#9999 Every day in last quarter of year: all holidays\
which are not on a Sunday%x %P
%? special texts
The following inclusive day periods %? special texts
are respected, at which inclusive is meant for the period
which is not excluded.
%v%x%a%c%f%g%h%l%p%q%r%? special texts
The following exclusive day periods %? special texts
are respected, at which exclusive is meant for the period
which is excluded.
%V%X%A%C%F%G%H%L%P%Q%R%?... special texts for text replacement%?... special texts which are replaced by particular texts
at program run-time causes the interspersing of data into the fixed date text,
which quality is essentially depending on the command line arguments given
for running the program. The complete special text is always replaced
accordingly in output if the fixed date text must be displayed.
Cleverly combined, these special texts also offer very effective mechanisms used for the definition of particular texts in a highly flexible manner, for example:
0*d1#999 Every day of year: Today is %K, the %n (%N)
%?[date] special textsApart from different representations of a weekday name, it is possible to create its weekday number. Likewise, the current day-of-year number, the day number, the week number, the month name, the month number, the year number, the Moon phase, the biorhythm, and some useful difference values can be produced.
For the date argument these %?[date]
special text may have, the following rules concerning definite omission
values are valid, elucidated by using the
yyyy[mm[dd|wwwn]]
date format82:
0000, the current year is assumed for the year.
00, the current month is assumed for
the month, and the December is assumed in case mm is set to 99.
00, the current day is
assumed for the day, and the last day of the month is assumed in case
dd is set to 99.
1...5 or 9),
then a www field must also be specified.
%[format]K[date] special text%K[date]The text ‘Today is %K , the %n’ will be expanded to
==> ‘Today is Monday, the 10-Jun-1996’, in case the actual system date is the 10th June 1996.
%>3#K[date]The text ‘Today is %>3#K0@t+1 , the %n+1’ will be expanded to
==> ‘Today is Tue, the 11-Jun-1996’, in case the actual system date is the 10th June 1996.
%>2#K[date]The text ‘Today is %>2#K , the %n’ will be expanded to
==> ‘Today is Mo, the 10-Jun-1996’, in case the actual system date is the 10th June 1996.
%[format]?[date] special texts
The following weekday number
%[format]?[date]
special texts are respected, e.g.:
%W[date]The text ‘Today is weekday %W , the %n’ will be expanded to
==> ‘Today is weekday 1, the 10-Jun-1996’, in case the actual system date is the 10th June 1996.
%>1&*W[date]The text ‘Today is weekday %>1&*W0@t+1 , the %n+1’ will be expanded to
==> ‘Today is weekday 2nd, the 11-Jun-1996’, in case the actual system date is the 10th June 1996.
%E[date]The text ‘Today is weekday %E , the %n’ will be expanded to
==> ‘Today is weekday 0, the 10-Jun-1996’, in case the actual system date is the 10th June 1996.
%>1&*E[date]The text ‘Today is weekday %>1&*E , the %n’ will be expanded to
==> ‘Today is weekday 0th, the 10-Jun-1996’, in case the actual system date is the 10th June 1996.
%I[date]The text ‘Today is weekday %I , the %n’ will be expanded to
==> ‘Today is weekday 2, the 10-Jun-1996’, in case the actual system date is the 10th June 1996.
%>1&*I[date]The text ‘Today is weekday %>1&*I , the %n’ will be expanded to
==> ‘Today is weekday 2nd, the 10-Jun-1996’, in case the actual system date is the 10th June 1996.
%J[date]The text ‘Today is weekday %J , the %n’ will be expanded to
==> ‘Today is weekday 1, the 10-Jun-1996’, in case the actual system date is the 10th June 1996.
%>1&*J[date]The text ‘Today is weekday %>1&*J , the %n’ will be expanded to
==> ‘Today is weekday 1st, the 10-Jun-1996’, in case the actual system date is the 10th June 1996.
%S[date]The text ‘Today is weekday %S , the %n’ will be expanded to
==> ‘Today is weekday 4, the 10-Jun-1996’, in case the actual system date is the 10th June 1996 and Friday (==5) is the starting day of week.
%>1&*S[date]The text ‘Today is weekday %>1&*S , the %n’ will be expanded to
==> ‘Today is weekday 4th, the 10-Jun-1996’, in case the actual system date is the 10th June 1996 and Friday (==5) is the starting day of week.
%T[date]The text ‘Today is weekday %T , the %n’ will be expanded to
==> ‘Today is weekday 3, the 10-Jun-1996’, in case the actual system date is the 10th June 1996 and Friday (==5) is the starting day of week.
%>1&*T[date]The text ‘Today is weekday %>1&*T , the %n’ will be expanded to
==> ‘Today is weekday 3rd, the 10-Jun-1996’, in case the actual system date is the 10th June 1996 and Friday (==5) is the starting day of week.
%[format]N[date] special text%N[date]The text ‘Day %N of year, the %n’ will be expanded to
==> ‘Day 53 of year, the 22-Feb-1996’, in case the actual system date is the 22nd February 1996.
%>03*N[date]The text ‘Day %>03*N0@t-1 of year, the %n-1’ will be expanded to
==> ‘Day 052 of year, the 21-Feb-1996’, in case the actual system date is the 22nd February 1996.
%>1&*N[date]The text ‘Day %>1&*N of year, the %n’ will be expanded to
==> ‘Day 53rd of year, the 22-Feb-1996’, in case the actual system date is the 22nd February 1996.
%>03&*N[date]The text ‘Day %>03&*N of year, the %n’ will be expanded to
==> ‘Day 053rd of year, the 22-Feb-1996’, in case the actual system date is the 22nd February 1996.
%[format]D[date] special text%D[date]The text ‘Day %D , %n’ will be expanded to
==> ‘Day 2, 02-Feb-1996’, in case the actual system date is the 2nd February 1996.
%>02*D[date]The text ‘Day %>02*D0@t-1 , %n-1’ will be expanded to
==> ‘Day 01, 01-Feb-1996’, in case the actual system date is the 2nd February 1996.
%>1&*D[date]The text ‘Day %>1&*D , %n’ will be expanded to
==> ‘Day 2nd, 02-Feb-1996’, in case the actual system date is the 2nd February 1996.
%>02&*D[date]The text ‘Day %>02&*D , %n’ will be expanded to
==> ‘Day 02nd, 02-Feb-1996’, in case the actual system date is the 2nd February 1996.
%k[date] special text%k[date]The text ‘Today is %K of week %k’ will be expanded to
==> ‘Today is Monday of week 24’, in case the actual system date is the 10th June 1996.
%[format]U[date] special text%U[date]The text ‘Today is %U , %n’ will be expanded to
==> ‘Today is June, 10-Jun-1996’, in case the actual system date is the 10th June 1996.
%>3#U[date]The text ‘Today is %>3#U19961010 , %n’ will be expanded to
==> ‘Today is Oct, 10-Jun-1996’, in case the actual system date is the 10th June 1996.
%[format]M[date] special text%M[date]The text ‘Month %M , %n’ will be expanded to
==> ‘Month 2, 22-Feb-1996’, in case the actual system date is the 22nd February 1996.
%>02*M[date]The text ‘Month %>02*M000001 , %n’ will be expanded to
==> ‘Month 01, 22-Feb-1996’, in case the actual system date is the 22nd February 1996.
%>1&*M[date]The text ‘Month %>1&*M , %n’ will be expanded to
==> ‘Month 2nd, 22-Feb-1996’, in case the actual system date is the 22nd February 1996.
%>02&*M[date]The text ‘Month %>02&*M , %n’ will be expanded to
==> ‘Month 02nd, 22-Feb-1996’, in case the actual system date is the 22nd February 1996.
%[format]Y[date] special text%Y[date]The text ‘Year %Y , %n’ will be expanded to
==> ‘Year 933, 22-Feb-0933’, in case the actual system date is the 22nd February 933.
%>04*Y[date]The text ‘Year %>04*Y0015 , %n’ will be expanded to
==> ‘Year 0015, 22-Feb-0933’, in case the actual system date is the 22nd February 933.
%[format]?[date] special texts
Gcal uses a very simple algorithm for detecting the Moon phase, which computes
approximate values only. The Moon phase is always calculated for 0 o'clock
Universal time (UTC/GMT).
See Calendar option --time-offset=argument,
how to change the base time for which the astronomical functions
are calculated. The following Moon phase
%[format]?[date] special texts
are respected:
%O[date]The text ‘Moon phase %O , %n’ will be expanded to
==> ‘Moon phase 94%+, 22-Dec-1996’, in case the actual system date is the 22nd December 1996.
The constructed Moon phase text consists of a percent value, which informs
about the illuminated fraction of the Moon's disk, and a trailing sign that
tells something about the state of the Moon. A trailing ‘+’ sign
indicates a waxing Moon, a ‘-’ sign a waning Moon, a ‘@’ sign
indicates the Full Moon phase, and a ‘!’ sign the New Moon phase.
%>03*O[date]The text ‘Moon phase %>03*O0@t+1 , %n+1’ will be expanded to
==> ‘Moon phase 098%+, 23-Dec-1996’, in case the actual system date is the 22nd December 1996.
The constructed Moon phase text consists of a percent value, which informs
about the illuminated fraction of the Moon's disk, and a trailing sign that
tells something about the state of the Moon. A trailing ‘+’ sign
indicates a waxing Moon, a ‘-’ sign a waning Moon, a ‘@’ sign
indicates the Full Moon phase, and a ‘!’ sign the New Moon phase.
%Z[date]The text ‘Date %n %Z --- Moon phase %>03*O ~Text’ will be expanded to
==> ‘Date 08-Mar-1995 ’
==> ‘ ( @@@@@@’
==> ‘ ( @@@@@@@@@’
==> ‘ ( @@@@@@@@@@@’
==> ‘ ( @@@@@@@@@@@@’
==> ‘ ( @@@@@@@@@@@@@’
==> ‘( @@@@@@@@@@@@@’
==> ‘( @@@@@@@@@@@@@’
==> ‘ ( @@@@@@@@@@@@@’
==> ‘ ( @@@@@@@@@@@@’
==> ‘ ( @@@@@@@@@@@’
==> ‘ ( @@@@@@@@@’
==> ‘ ( @@@@@@@ --- Moon phase 041%+’
==> ‘Text’, in case the actual system date is the 8th March 1995.
See Fixed date option --moonimage-lines=number, how to change the size of a Moon phase text graphics.
A possibly specified format within this special text is ignored by Gcal.
%?[date] special textsGcal is able to create a biorhythm for any specified date of birth. The created text shows the three standard biorhythm cycles, and that are the 28 day emotional cycle, the 33 day intellectual cycle, and the 23 day physical cycle. The emotional cycle governs sensibility, nerves, moodiness, and creative ability. The intellectual cycle reflects intelligence, memory, mental alertness, and reasoning power. The physical cycle represents physical strength, endurance, energy and resistance. All cycles start in the zero point at the date of birth and swing like sine curves between their positive and negative maximum values. The periods above the zero point show the days of full vitality and efficiency while the periods below the zero point indicate days of reduced efficiency. The biorhythm is implemented for entertaining purposes only! It is up to the user to interpret the biorhythm texts.
Gcal counts critical days, positive likewise negative days. Critical days are those days in which one or more of the biological cycles crosses the zero point. At that time, one's system is said to be in a state of flux and it may be desirable to exhibit caution. Positive days are those days in which one or more of the biological cycles have a positive maximum value. At that time, one's system is said to be in a raised state. Negative days are those days in which one or more of the biological cycles have a negative maximum value. At that time, one's system is said to be in a lessen state.
The following biorhythm %?[date] special texts
are respected:
%,[date]The text ‘%,19620921’ will be expanded to
==> ‘1! 0+ 0- , Emo=+022%- Int=-091%+ Phy=-014%-’, in case the actual system date is the 12th December 1996.
The preceding example shows the calculated biorhythm expressed as a series of values for a person born in 1962, September 21st. The constructed text consists of two parts, and that is on the one hand a triplet of total values which indicate the critical, positive and negative day. And on the other hand a triplet of values which indicate the emotional, intellectual and physical cycle.
In the first triplet of total values, a ‘!’ suffix means a critical day, a ‘+’ indicates a positive day, and a ‘-’ suffix marks a negative day.
In the second triplet of values, each single cycle percent value consists of
a leading positive or negative sign that tells something about the distance
of this value to the zero point, and a trailing character that tells something
about the state of each cycle. A trailing ‘+’ character marks a waxing
phase, a ‘-’ suffix means a waning phase, and a ‘@’ indicates the
maximum value of a phase.
%;[date]The text ‘%;19620921’ will be expanded to
==> ‘0- I P 1 E +0’, in case the actual system date is the 12th December 1996.
The preceding example shows the calculated biorhythm expressed as a text graphics line for a person born in 1962, September 21st. The constructed line is a bar with a negative and positive axis of adjustable length (see Fixed date option --biorhythm-axis=number), which left margin is represented by the total value of the negative days (the ‘0-’ in this case), and which right margin is represented by the total value of the positive days (the ‘+0’ in this case). The zero point of the co-ordinate is represented by the total value of the critical days, which is the ‘1’ in this case. The emotional, intellectual and the physical phase value is accordingly placed in scaled manner on this bar, and that by using the initial letter of the cycle in each case (‘E’, ‘I’ and ‘P’). Coincidental phase values are marked by a ‘@’ character.
%[format]?[date] special texts
The following difference value %[format]?[date]
special texts are respected:
%ydateThe text ‘Sylvester 1912 is %y1912 years ago’ will be expanded to
==> ‘Sylvester 1912 is -82 years ago’, in case the year of the actual system date is 1994.
%B[date]The text ‘My %B1962 birthday%i1952#2062’ will be expanded to
==> ‘My 32 birthday’, in case the year of the actual system date is 1994.
Those age values are only displayed, if the computation of an age
value is greater zero. The fixed date warning in preceding example
is displayed only in case the current year is greater than 1952 and less
than 2062.
%>1&*B[date]The text ‘My %>1&*B1962 birthday%i1952#2062’ will be expanded to
==> ‘My 32nd birthday’, in case the year of the actual system date is 1994.
Those age values are only displayed, if the computation of an age value is greater zero. The fixed date warning in preceding example is displayed only in case the current year is greater than 1952 and less than 2062.
%[format]?[argument] special textsApart from different representations of the actual system time, a fixed format date text can be created. Moreover, it is possible to produce a day number, which bears the Julian date as base date and which can be deferred if needed. Furthermore, the approximate distance and the course angle between two geographic point locations, and different Sun and Moon oriented data and times for at pleasure any geographical location can be created. It is also possible to display the contents of environment variables in the fixed date text.
For the argument these %?[argument]
special texts may have, no special rules concerning definite omission
values are valid.
%[format]?[argument] special texts
Gcal is able to represent the actual clocktime as local/zone time
and as Universal time (UTC/GMT), and additionally the
RFC-82283 style numerical Universal time timezone offset
value and the actual numerical local time timezone offset value.
See Actual local time %t[argument] special text,
for the detailed description of all components of the argument,
which may trail the actual clocktime
%[format]?[argument]
special texts. All actual clocktime
%[format]?[argument]
special texts must always be trailed by a whitespace
character which is removed in output! The following actual clocktime
%[format]?[argument]
special texts are respected:
%t[argument]%t[*][[+|-]mmmm|hh:[mm]]
references the actual local time, which is displayed by using
the hh:mm output format, e.g.:
The text ‘Local time: %t --> Dentist at 10:00’ will be expanded to
==> ‘Local time: 07:32 --> Dentist at 10:00’, in case the actual local time value is 07:32 o'clock (hh:mm).
If only %t is specified, the local time value will implicitly be
displayed by using the 24-hours format. For displaying using the
12-hours format, add a ‘*’ character directly behind %t,
e.g. ‘%t*’.
A displacement value may trail the %t special text, which has to
be specified either by using the [+|-]mmmm
format or the [+|-]hh:[mm]
format. [+|-]mmmm adds respectively subtracts
the specified amount of minutes mmmm from the local time value
(range 0...9999), while
[+|-]hh:[mm] adds respectively
subtracts the given amount of hours hh (range 0...99)
and minutes mm (range 0...59) from the local time
value. The displacement value is always added to the local time value in
case it is specified without a +|- sign. In case Gcal is
unable to compute the actual local time in hh:mm format
by reason of a misspecified argument, a ??:?? text will
be created instead of the actual local time in hh:mm
format.
The text ‘Local time: %t-3: --> Dentist at 10:00’ will be expanded to
==> ‘Local time: 04:32 --> Dentist at 10:00’, in case the actual local time value is 07:32 o'clock (hh:mm).
%[format]'[argument]%[format]'[[+|-]mmmm|hh:[mm]]
references the actual local time in minutes since midnight, which is
displayed by using the m[m...] output format, e.g.:
The text ‘Local time: %' --> Dentist at 10:00’ will be expanded to
==> ‘Local time: 452 --> Dentist at 10:00’, in case the actual local time value is 07:32 o'clock (hh:mm).
In case Gcal is unable to compute the actual local time in
m[m...] format by reason of a misspecified
argument, a ?? text will be created instead of the actual
local time in m[m...] format.
%[format]_[argument]%[format]_[*][[+|-]mmmm|hh:[mm]]
references the actual local time hour, which is displayed by using
the h[h...] output format, e.g.:
The text ‘Local time hour: %_-1:’ will be expanded to
==> ‘Local time hour: 6’ in case the actual local time value is 07:32 o'clock (hh:mm).
In case Gcal is unable to compute the actual local time hour by reason
of a misspecified argument, a ?? text will be created
instead of the actual local time hour h[h...].
%[format]?[argument]%[format]?[[+|-]mmmm|hh:[mm]]
references the actual local time minute, which is displayed by using
the m[m...] output format, e.g.:
The text ‘Local time minute: %>04*?+:2’ will be expanded to
==> ‘Local time minute: 0034’ in case the actual local time value is 07:32 o'clock (hh:mm).
In case Gcal is unable to compute the actual local time minute by reason
of a misspecified argument, a ?? text will be created
instead of the actual local time minute m[m...].
%[format]{[argument]%[format]{[[+|-]mmmm|hh:[mm]]
references the actual local time 12-hour format suffix, which is
displayed as am|pm, e.g.:
The text ‘Local time suffix: %{’ will be expanded to
==> ‘Local time suffix: am’ in case the actual local time value is 07:32 o'clock (hh:mm).
In case Gcal is unable to compute the actual local time 12-hour format suffix
by reason of a misspecified argument, a ?? text will be created
instead of the actual local time 12-hour format suffix am|pm.
%@[argument]%@[*][[+|-]mmmm|hh:[mm]]
references the actual Universal time (UTC/GMT), which is displayed
by using the hh:mm/date output format, e.g.:
The text ‘Universal time: %@*-3.’ will be expanded to
==> ‘Universal time: 03:32am/15-Feb-1999’, in case the actual date is the 15th February 1999 and the actual Universal time value is 06:32 o'clock (hh:mm).
In case Gcal is unable to compute the actual Universal time in
hh:mm/date format by reason of a misspecified
argument, a ??:??/??-???-???? text will be created instead
of the actual Universal time in hh:mm/date format.
%[format]`[argument]%[format]`[[+|-]mmmm|hh:[mm]]
references the actual Universal time in minutes since midnight, which
is displayed by using the m[m...]/date
output format, e.g.:
The text ‘Universal time: %>06*`-3:’ will be expanded to
==> ‘Universal time: 000212/15-Feb-1999’ in case the actual date is the 15th February 1999 and the actual Universal time value is 06:32 o'clock (hh:mm).
In case Gcal is unable to compute the actual Universal time in
m[m...]/date format by reason
of a misspecified argument, a ??/??-???-???? text will
be created instead of the actual Universal time in
m[m...]/date format.
%[format].[argument]%[format].[*][[+|-]mmmm|hh:[mm]]
references the actual Universal time hour, which is displayed
by using the h[h...] output format, e.g.:
The text ‘Universal time hour: %.-1:’ will be expanded to
==> ‘Universal time hour: 5’ in case the actual Universal time value is 06:32 o'clock (hh:mm).
In case Gcal is unable to compute the actual Universal time hour by reason
of a misspecified argument, a ?? text will be created
instead of the actual Universal time hour h[h...].
%[format]/[argument]%[format]/[[+|-]mmmm|hh:[mm]]
references the actual Universal time minute, which is displayed
by using the m[m...] output format, e.g.:
The text ‘Universal time minute: %>04*/+:2’ will be expanded to
==> ‘Universal time minute: 0034’ in case the actual Universal time value is 06:32 o'clock (hh:mm).
In case Gcal is unable to compute the actual Universal time minute by reason
of a misspecified argument, a ?? text will be created
instead of the actual Universal time minute m[m...].
%[format]}[argument]%[format]}[[+|-]mmmm|hh:[mm]]
references the actual Universal time 12-hour format suffix, which is
displayed as am|pm, e.g.:
The text ‘Universal time suffix: %>1w*}+10:’ will be expanded to
==> ‘Universal time suffix: Pm’ in case the actual Universal time value is 06:32 o'clock (hh:mm).
In case Gcal is unable to compute the actual Universal time 12-hour format
suffix by reason of a misspecified argument, a ?? text will
be created instead of the actual Universal time 12-hour format suffix
am|pm.
%"[argument]%"[[+|-]mmmm|hh:[mm]]
references the RFC-822 style numerical Universal time
timezone offset value, which is displayed by using the
+|-hhmm output format, e.g.:
The text ‘Universal time timezone offset value: %"-90’ will be expanded to
==> ‘Universal time timezone offset value: -0130’, at which calculations are always based on the timezone of the Universal time UTC/GMT.
In case Gcal is unable to compute the numerical Universal time timezone offset
value by reason of a misspecified argument, a +???? text
will be created instead of the numerical Universal time timezone offset value
+|-hhmm.
%=[argument]%=[[+|-]mmmm|hh:[mm]]
references the RFC-822 style actual numerical local time
timezone offset value, which is displayed by using the
+|-hhmm output format, e.g.:
The text ‘Local time timezone offset value CET: %=-10’ will be expanded to
==> ‘Local time timezone offset value CET: +0050’, in case the actual timezone is equal the Central European (winter)time CEWT/CET (+hhmm). Calculations are always based on the timezone of the local time.
In case Gcal is unable to compute the actual numerical local time timezone
offset value by reason of a misspecified argument, a +????
text will be created instead of the actual numerical local time timezone offset
value +|-hhmm.
%n[argument] special text
%n[[+|-]n] references the current respectively
queried day number relative to the current date
‘+/-’ n
days and is replaced by a date text by using the fixed
‘%>02*D-%>3#U-%>04*Y’ format, e.g.:
The resource file line ‘1962Sep21 10000 days old: %n+10000’ will be expanded to
==> ‘10000 days old: 06-Feb-1990’, in case you call Gcal with the simple -c option and the command sep 1962 (see Single command mm yyyy).
%[format]j[argument] special text
%[format]j[[+|-]n] references the
current respectively queried Julian day number relative to the actual
system date (==today). This day number is based on the date 1st
January 4713 BCE —which is the starting day zero of a consecutive day
counting used in astronomical computations— and is known as the Julian
Date (J.D.). The real zero of this date is at 12 o'clock Universal time
(UTC/GMT); the day does not change at midnight, but at noon Universal
time. Here, Gcal does not evaluate the timezone returned by the systems
date function. For that reason, this day number is represented
without a time fraction on the supposition that the day has already changed
at noon. If you do not like the feature that the day displayed has already
changed at noon, you can decrease the resulting Julian day number of that
special text always by one, e.g. ‘%j-1’.
For example:
The resource file line ‘0 Julian day %j since 01-Jan-4713 BCE’ will be expanded to
==> ‘Julian day 2437929 since 01-Jan-4713 BCE’, in case you call Gcal with the -c %19620921 option and no command.
If the %[format]j text is directly trailed by an unsigned
number, this number is always subtracted from the real Julian day number. So
you are able to work with any quantities referenced, e.g.:
The resource file line ‘0 Julian day %j2415021 since 01-Jan-1900’ will be expanded to
==> ‘Julian day 4 since 01-Jan-1900’, in case you call Gcal with the -c %19000105 option and no command.
%[format]bargument special text
%[format]b[*][mode]ISO-6709:1983-co-ordinate-1/ISO-6709:1983-co-ordinate-2
references either the approximate air line distance or the
approximate course angle (true track)84 between any of two geographic point locations. The selection,
which value has to be calculated by using this special text is done by
specifying the mode part of the preceding argument. Actually,
exactly three different modes can be used that are represented by the
‘0’...‘2’ characters:
If no mode is given, Gcal automatically uses that mode, which is enabled by the mode character ‘0’. If a mode character is given that is not according to one of the ‘0’...‘2’ characters, Gcal also automatically uses that mode, which is enabled by the mode character ‘0’.
After the optional style and mode characters, the latitude and longitude of the geographic co-ordinates follows, for which the calculations must be made. They must be conform the ISO-6709:1983 standard representation of latitude and longitude for geographic point locations. The two co-ordinates have to be separated by a ‘/’ termination character from each other.
See Arguments of the Sun oriented special texts, for the detailed description of the components of the ISO-6709:1983 standard representation of latitude and longitude for geographic point locations.
For example:
The text ‘Distance Paris-Tokyo: %b+4852+00220/+3542+13946 km’ will be expanded to
==> ‘Distance Paris-Tokyo: 9746km’.
The text ‘Distance Paris-Tokyo: %b*0+4852+00220/+3542+13946 ms’ will be expanded to
==> ‘Distance Paris-Tokyo: 6056ms’.
The text ‘Course angle Paris-Tokyo: %b1+4852+00220/+3542+13946’ will be expanded to
==> ‘Course angle Paris-Tokyo: 033d22'’.
The text ‘Course angle Tokyo-Paris: %b*2+4852+00220/+3542+13946’ will be expanded to
==> ‘Course angle Tokyo-Paris: 333.548’.
While praying, people of Islamic faith always turn their heads into the direction of Makkah, Saudi-Arabia. Now by means of Gcal, these people can easily find out for their respective location, where they have to turn to, and that by:
%b1ISO-6709:1983-co-ordinate-1/+212516+0394929
where ISO-6709:1983-co-ordinate-1 is simply replaced by the co-ordinate of the respective location.
See Fixed date option --precise, how to obtain a more precise representation of the values that are caused by this special text.
This special text must always be trailed by a whitespace character which is removed in output!
%[format]?argument special texts
%[format]o[*][mode]ISO-6709:1983-co-ordinate[,[+|-]mmmm|hh:[mm]]
references the approximate time of sunrise by default,
%[format]s[*][mode]ISO-6709:1983-co-ordinate[,[+|-]mmmm|hh:[mm]]
references the approximate time of sunset by default,
%[format]u[*][mode]ISO-6709:1983-co-ordinate[,[+|-]mmmm|hh:[mm]]
references the approximate period of visibility of the Sun
(solar day length) by default,
%[format]z[*][mode]ISO-6709:1983-co-ordinate[,[+|-]mmmm|hh:[mm]]
references the approximate period of non-visibility of the Sun
(solar night length) by default.
All these special texts can be used for at pleasure any geographic point location, i.e. it is possible to determine different astronomical values for any location on the globe, and that for at pleasure any clocktime with a resolution of a single minute within the period of the years AD 1 until AD 9999, that is respected by Gcal.
The selection which value has to be calculated by these special texts is done by specifying the mode part of the preceding argument. Actually, exactly 54 different modes can be used that are represented by the ‘0’...‘9’, ‘a’...‘z’ and ‘A’...‘R’ characters, and which create different kind of results that are depending on the special text used. First of all, here is a table in which all usable modes are described and explained sufficiently. You can also see from this table, which Sun oriented special text or texts are corresponding to which mode, i.e. cause the determination of an astronomical value as it is described in the table:
| Mode | Special text | Description
|
|
| ||
0
| o, s
| Calculates the approximate midnight time of the Sun.
The astronomical midnight time of the Sun is at that clocktime, when the
Sun holds an azimuth (horizontal angular distance between the vertical
circle, that passes the Sun, and the North point) of either precisely
0 degrees of precisely 180 degrees (noon line), which depends on
the season and the geographical location.
At that clocktime, the Sun is close its lowest culmination point,
i.e. close the lowest point below or above the horizontal plane the
Sun transits during this day.
|
|
| ||
1
| o, s
| Calculates the approximate noon time of the Sun.
The astronomical noon time of the Sun is at that clocktime, when
the Sun holds an azimuth of either precisely 180 degrees of precisely
0 degrees (noon line), which depends on the season and the geographical
location.
At that clocktime, the Sun is close its highest culmination point,
i.e. close the highest point above or below the horizontal plane the
Sun transits during this day.
People of Islamic faith normally pray for the second time on the day
during the period, which is between the astronomical noon time of the
Sun (or some minutes later) and the Islamic prayer time by the name
of Asr. These people commonly use the term Zuhr for this
prayer time. The timing of Asr depends on the length of the shadow
cast by a vertical pole (gnomon). According to the Shafi school
of jurisprudence, Asr begins when the length of the shadow of a vertical
pole exceeds the length of the pole. According to the Hanafi school of
jurisprudence, Asr begins when the length of the shadow exceeds twice
the length of the vertical pole. In both cases, the minimum length of
the shadow at astronomical noon time of the Sun is subtracted from the
length of the shadow before comparing it with the length of the pole.
See Islamic Asr-1 prayer time,
and
Islamic Asr-2 prayer time,
for further details.
|
|
| ||
2
| o
| Calculates the approximate time when the center of the Sun
passes a reference altitude of 0 degrees on a mathematical-geocentric
horizon in the morning; thus rising.
A mathematical horizon is a purely geometrically-built horizon which
disregards the phenomenon of refraction as it arises in reality by the
influence of the Earth's atmosphere. A geocentrical horizon is the
horizontal plane that passes through the Earth's center, orthogonal
to the observer's local vertical. In the further context, the shorter
term mathematical horizon is used which actually means the
mathematical-geocentric horizon.
|
|
| ||
2
| s
| Calculates the approximate time when the center of the Sun
passes a reference altitude of 0 degrees on a mathematical horizon
in the evening; thus setting.
|
|
| ||
2
| u
| Calculates the approximate period while the center of the Sun
is above a reference altitude of 0 degrees on a mathematical horizon;
thus is visible.
|
|
| ||
2
| z
| Calculates the approximate period while the center of the Sun
is below a reference altitude of 0 degrees on a mathematical horizon;
thus is non-visible.
|
|
| ||
3
| o
| Calculates the approximate time when the upper limb of the Sun
passes a reference altitude of 0 degrees on a mathematical horizon
in the morning; thus rising.
The above mentioned reference altitude is computed from the
value of the Sun's semidiameter as it appear at that clocktime.
If the reference altitude that is referring to the Sun's upper limb is
converted to a reference altitude that is referring to the Sun's center,
this results in a value of about 16 arcminutes below the geocentric horizon.
|
|
| ||
3
| s
| Calculates the approximate time when the upper limb of the Sun
passes a reference altitude of 0 degrees on a mathematical horizon
in the evening; thus setting.
The above mentioned reference altitude is computed from the
value of the Sun's semidiameter as it appear at that clocktime.
|
|
| ||
3
| u
| Calculates the approximate period while the upper limb of the Sun
is above a reference altitude of 0 degrees on a mathematical horizon;
thus is visible.
|
|
| ||
3
| z
| Calculates the approximate period while the upper limb of the Sun
is below a reference altitude of 0 degrees on a mathematical horizon;
thus is non-visible.
|
|
| ||
4
| o
| Calculates the approximate time when the center of the Sun
passes a reference altitude of 34 arcminutes below the geocentric
horizon in the morning; thus rising.
The phenomenon of refraction is already respected in this as it arises in
reality by the influence of the Earth's atmosphere, and that with the standard
value of 34 arcminutes, which can indirectly be changed by using the
--atmosphere option.
Fixed dates option --atmosphere=air-pressure[,temperature],
how to change the base data of the atmosphere, so that the atmospheric
conditions as defined by it are used to calculate the amount of refraction.
|
|
| ||
4
| s
| Calculates the approximate time when the center of the Sun
passes a reference altitude of 34 arcminutes below the geocentric
horizon in the evening; thus setting.
The phenomenon of refraction is already respected in this as it arises in
reality by the influence of the Earth's atmosphere, and that with the standard
value of 34 arcminutes, which can indirectly be changed by using the
--atmosphere option.
|
|
| ||
4
| u
| Calculates the approximate period while the center of the Sun
is above a reference altitude of 34 arcminutes below the geocentric
horizon; thus is visible.
|
|
| ||
4
| z
| Calculates the approximate period while the center of the Sun
is below a reference altitude of 34 arcminutes below the geocentric
horizon; thus is non-visible.
|
|
| ||
5
| o
| Calculates the approximate time when the upper limb of the Sun
passes a reference altitude of 34 arcminutes below the geocentric
horizon in the morning; thus rising.
This kind of rise time calculation is done according to the standard
calculation method as it is commonly used internationally.
The phenomenon of refraction is already respected in this as it arises in
reality by the influence of the Earth's atmosphere, and that with the standard
value of 34 arcminutes, which can indirectly be changed by using the
--atmosphere option.
Fixed dates option --atmosphere=air-pressure[,temperature],
how to change the base data of the atmosphere, so that the atmospheric
conditions as defined by it are used to calculate the amount of refraction.
The above mentioned reference altitude is computed from the respective
values of the Sun's semidiameter and (standard) refraction as they appear
at that clocktime.
If the reference altitude that is referring to the Sun's upper limb is
converted to a reference altitude that is referring to the Sun's center,
this results in a value of about 50 arcminutes below the geocentric horizon.
|
|
| ||
5
| s
| Calculates the approximate time when the upper limb of the Sun
passes a reference altitude of 34 arcminutes below the geocentric
horizon in the evening; thus setting.
This kind of set time calculation is done according to the standard
calculation method as it is commonly used internationally.
The phenomenon of refraction is already respected in this as it arises in
reality by the influence of the Earth's atmosphere, and that with the standard
value of 34 arcminutes, which can indirectly be changed by using the
--atmosphere option.
The above mentioned reference altitude is computed from the respective
values of the Sun's semidiameter and (standard) refraction as they appear
at that clocktime.
People of Islamic faith normally pray for the second-last time on the
day at this clocktime, or some minutes later. These people commonly
use the term Maghrib for this prayer time.
|
|
| ||
5
| u
| Calculates the approximate period while the upper limb of the Sun
is above a reference altitude of 34 arcminutes below the geocentric
horizon; thus is visible.
This kind of visibility period calculation is done according to the standard
calculation method as it is commonly used internationally.
|
|
| ||
5
| z
| Calculates the approximate period while the upper limb of the Sun
is above a reference altitude of 34 arcminutes below the geocentric
horizon; thus is non-visible.
This kind of non-visibility period calculation is done according to the
standard calculation method as it is commonly used internationally.
|
|
| ||
6
| o
| Calculates the approximate time when the center of the Sun
passes a reference altitude of 6 degrees below a mathematical horizon
in the morning; thus the beginning of civil twilight.
The scattered light of the Sun that is remaining at the beginning of the
civil twilight phase is in general not yet sufficient for reading outside
without artificial illumination.
|
|
| ||
6
| s
| Calculates the approximate time when the center of the Sun
passes a reference altitude of 6 degrees below a mathematical horizon
in the evening; thus the ending of civil twilight.
|
|
| ||
6
| u
| Calculates the approximate period while the center of the Sun
is above a reference altitude of 6 degrees below a mathematical horizon;
thus the period, while the center of the Sun is always above -6 degrees.
|
|
| ||
6
| z
| Calculates the approximate period while the center of the Sun
is below a reference altitude of 6 degrees below a mathematical horizon;
thus the period, while the center of the Sun is always below -6 degrees.
|
|
| ||
7
| o
| Calculates the approximate time when the center of the Sun
passes a reference altitude of 12 degrees below a mathematical horizon
in the morning; thus the beginning of nautical twilight.
The scattered light of the Sun that is remaining at the beginning of the
nautical twilight phase is in general not yet sufficient for navigation
using a sea horizon.
|
|
| ||
7
| s
| Calculates the approximate time when the center of the Sun
passes a reference altitude of 12 degrees below a mathematical horizon
in the evening; thus the ending of nautical twilight.
|
|
| ||
7
| u
| Calculates the approximate period while the center of the Sun
is above a reference altitude of 12 degrees below a mathematical horizon;
thus the period, while the center of the Sun is always above -12 degrees.
|
|
| ||
7
| z
| Calculates the approximate period while the center of the Sun
is below a reference altitude of 12 degrees below a mathematical horizon;
thus the period, while the center of the Sun is always below -12 degrees.
|
|
| ||
8
| o
| Calculates the approximate time when the center of the Sun
passes a reference altitude of 15 degrees below a mathematical horizon
in the morning; thus the beginning of amateur-astronomical twilight.
The scattered light of the Sun that is remaining at the beginning of the
amateur-astronomical twilight phase is in general yet so faint that most
astronomical observations can be made.
|
|
| ||
8
| s
| Calculates the approximate time when the center of the Sun
passes a reference altitude of 15 degrees below a mathematical horizon
in the evening; thus the ending of amateur-astronomical twilight.
|
|
| ||
8
| u
| Calculates the approximate period while the center of the Sun
is above a reference altitude of 15 degrees below a mathematical horizon;
thus the period, while the center of the Sun is always above -15 degrees.
|
|
| ||
8
| z
| Calculates the approximate period while the center of the Sun
is below a reference altitude of 15 degrees below a mathematical horizon;
thus the period, while the center of the Sun is always below -15 degrees.
|
|
| ||
8
| o
| Calculates the approximate time when the center of the Sun
passes a reference altitude of 18 degrees below a mathematical horizon
in the morning; thus the beginning of astronomical twilight.
No appreciable scattered sunlight is remaining at the beginning of the
astronomical twilight phase, the sky is completely dark yet.
People of Islamic faith normally pray for the first time on the day
during the period, which is between this clocktime and the time of
standard sunrise. These people commonly use the term Fajr
for this prayer time.
See Standard rise time of the Sun,
for further details.
|
|
| ||
9
| s
| Calculates the approximate time when the center of the Sun
passes a reference altitude of 18 degrees below a mathematical horizon
in the evening; thus the ending of astronomical twilight.
People of Islamic faith normally pray for the last time on the
day at this clocktime, or some minutes later. These people commonly
use the term Isha for this prayer time.
|
|
| ||
9
| u
| Calculates the approximate period while the center of the Sun
is above a reference altitude of 18 degrees below a mathematical horizon;
thus the period, while the center of the Sun is always above -18 degrees.
|
|
| ||
9
| z
| Calculates the approximate period while the center of the Sun
is below a reference altitude of 18 degrees below a mathematical horizon;
thus the period, while the center of the Sun is always below -18 degrees.
|
|
| ||
a
| o, s
| Calculates the approximate topocentric, apparent elevation
of the Sun, thus the vertical angular distance between the Sun's center
and the horizon, in degrees and arcminutes
as it happen at civil midnight time.
Results with a negative sign signify that the Sun's center is below the
horizon at the moment, and results with a positive sign mean that the
momentary center of the Sun is above the horizon.
Observations of celestial objects that are done from the surface of the
Earth yield in topocentrically based data. The locations of the celestial
bodies are often at another place if the data is topocentrically determined
instead of determine it geocentrically, i.e. at the fictitious
center of the Earth.
This is mainly caused by the refraction, which raises a celestial body to
another location as it is been in reality. Because the terrestrial globe
flattens towards the pole caps and therefore cannot be taken as an ideally
shaped sphere, the individual Earth radius between the observer's location
and the center of the Earth also affects the computation of
topocentrically based data.
|
|
| ||
b
| o, s
| Calculates the approximate topocentric, apparent azimuth
of the Sun in degrees and arcminutes
as it happen at civil midnight time.
|
|
| ||
c
| o, s
| Calculates the approximate topocentric, apparent declination
of the Sun, thus the vertical angular distance between the Sun's center
and the celestial equator, in degrees and arcminutes
as it happen at civil midnight time.
Results with a negative sign signify that the Sun's center is below the
celestial equator at the moment, and results with a positive sign mean
that the momentary center of the Sun is below the celestial equator.
|
|
| ||
d
| o, s
| Calculates the approximate topocentric, apparent ecliptic longitude
of the Sun, thus the horizontal angular distance between the Sun's center and
the vernal equinox point on the ecliptic (the zodiacal line or Sun's
orbit),
in degrees and arcminutes
as it happen at civil midnight time.
|
|
| ||
e
| o, s
| Calculates the approximate topocentric, apparent right ascension
of the Sun, thus the horizontal angular distance between the Sun's center and
the hour circle that passes through the vernal equinox point on the ecliptic,
as time value in hours and minutes
as it happen at civil midnight time.
|
|
| ||
f
| o, s
| Calculates the approximate topocentric, apparent distance
of the Sun from the Earth in astronomical units
as it happen at civil midnight time.
An astronomical unit, abbreviated by ae, is equal to the mean
distance of the Sun from the Earth, which is about 149,597,870.691
kilometers.
|
|
| ||
g
| o, s
| Calculates the approximate topocentric, apparent horizontal parallax
of the Sun in degrees and arcminutes
as it happen at civil midnight time.
The horizontal parallax of the Sun specifies the diameter of the Earth
as it is seen from the surface of the Sun.
|
|
| ||
h
| o, s
| Calculates the approximate topocentric, apparent semidiameter
of the Sun in degrees and arcminutes
as it happen at civil midnight time.
|
|
| ||
i
| o, s
| Calculates the approximate refraction of the Earth's atmosphere
in degrees and arcminutes
as it happen at civil midnight time.
|
|
| ||
j
| o, s
| Calculates the approximate geocentric, apparent elevation
of the Sun in degrees and arcminutes
as it happen at civil midnight time.
Results with a negative sign signify that the Sun's center is below the
horizon at the moment, and results with a positive sign mean that the
momentary center of the Sun is above the horizon.
|
|
| ||
k
| o, s
| Calculates the approximate geocentric, apparent azimuth
of the Sun in degrees and arcminutes
as it happen at civil midnight time.
|
|
| ||
l
| o, s
| Calculates the approximate geocentric, apparent declination
of the Sun in degrees and arcminutes
as it happen at civil midnight time.
Results with a negative sign signify that the Sun's center is below the
celestial equator at the moment, and results with a positive sign mean
that the momentary center of the Sun is above the celestial equator.
|
|
| ||
m
| o, s
| Calculates the approximate geocentric, apparent ecliptic longitude
of the Sun in degrees and arcminutes
as it happen at civil midnight time.
|
|
| ||
n
| o, s
| Calculates the approximate geocentric, apparent right ascension
of the Sun as time value in hours and minutes
as it happen at civil midnight time.
|
|
| ||
o
| o, s
| Calculates the approximate geocentric, apparent distance
of the Sun from the Earth in astronomical units
as it happen at civil midnight time.
|
|
| ||
p
| o, s
| Calculates the approximate geocentric, apparent horizontal parallax
of the Sun in degrees and arcminutes
as it happen at civil midnight time.
|
|
| ||
q
| o, s
| Calculates the approximate geocentric, apparent semidiameter
of the Sun in degrees and arcminutes
as it happen at civil midnight time.
|
|
| ||
r
| o, s
| Calculates the approximate delta-t in seconds
as it happen at civil midnight time.
Delta-t is the difference between the Terrestrial Dynamical time
(abbreviated by TDT), that was formerly known as Ephemeris
time (abbreviated by ET), and the Universal time (UT).
Thus, ‘delta-t == TDT - UT’.
|
|
| ||
s
| o, s
| Calculates the approximate, apparent location oriented
sidereal time (local sidereal time (LAST),
also known as local star time) in hours and minutes
as it happen at civil midnight time.
A star day is the period between two consecutive upper culminations
of the vernal equinox point on the ecliptic in the meridian of the observer's
location. Therefore, the local star time is the momentary period,
which is past between the last upper culmination of the vernal equinox
point in the meridian of the observer's location (the momentary hour angle
of the vernal equinox point), thus the right ascension of the stars in the
observer's meridian at the moment.
|
|
| ||
t
| o, s
| Outputs the base time as time value in hours and minutes,
for which the dynamical, i.e. depending on the respective clocktime,
astronomical data and times of the Sun are calculated.
Without a given --time-offset=argument option,
the astronomical data and times of the Sun are always calculated
for 0 o'clock Universal time (UTC/GMT).
See Calendar option --time-offset=argument,
for further details.
|
|
| ||
u
| o, s
| Calculates the approximate Julian date in days
as it happen at civil midnight time.
See Julian day number,
for further information about the Julian date.
|
|
| ||
v
| o, s
| Calculates the approximate Julian Ephemeris date,
thus a Julian date that is corrected by delta-t, in days
as it happen at civil midnight time.
|
|
| ||
w
| o, s
| Calculates the approximate difference between true solar time
and mean solar time as time value in hours and minutes
as it happen at civil midnight time.
This so-called equation of time is a correction to be added to the
true solar time —as read on a sundial— to obtain the mean solar time.
A true solar day is the period between two consecutive lower
culminations of the Sun. This entity is taken as the base for deriving
the true solar time (as it is also shown by a sundial during the day). A
star day is also known as a mean solar day. Because the Sun apparently
shifts with respect to the vernal equinox point on the ecliptic due to
the Earth's orbit around the Sun, the star day and the true solar day
have a different length. As the true Sun namely moves irregularly through
the ecliptic, a fictitious mean Sun with a symmetrical motion through
the celestial equator is used for deriving the mean solar time.
So, this difference in time is a consequence of the ellipticity and tilt
of the Earth's orbit, causing the irregular apparent movement of the Sun
across the sky.
|
|
| ||
x
| o, s
| Calculates the difference of the approximate topocentric,
apparent elevation of Sun and Moon (delta),
at which the Sun is used as the reference point,
in degrees and arcminutes
as it happen at civil midnight time.
Results with a negative sign signify that the momentary center of the Sun is
at an elevation that is below the momentary elevation of the Moon's center;
thus the Sun is lower than the Moon.
Results with a positive sign signify that the momentary center of the Sun is
at an elevation that is above the momentary elevation of the Moon's center;
thus the Sun is higher than the Moon.
|
|
| ||
y
| o, s
| Calculates the difference of the approximate topocentric,
apparent azimuth of Sun and Moon (delta),
at which the Sun is used as the reference point,
in degrees and arcminutes
as it happen at civil midnight time.
The result specifies the horizontal angular distance, by which the momentary
center of the Sun is distant from the momentary Moon's center, and that
measured at the vertical circles that pass the Sun and the North point
and the Moon and the North point.
Results with a negative sign signify that the Moon is to the right
(clockwise) of the Sun if one looks to the Sun — or alternatively
expressed, that the Sun is to the left (anti-clockwise) of the Moon.
Results with a positive sign signify that the Moon is to the left
(anti-clockwise) of the Sun if one looks to the Sun — or alternatively
expressed, that the Sun is to the right (clockwise) of the Moon.
|
|
| ||
z
| o, s
| Calculates the difference of the approximate geocentric,
apparent elevation of Sun and Moon (delta),
at which the Sun is used as the reference point,
in degrees and arcminutes
as it happen at civil midnight time.
|
|
| ||
A
| o, s
| Calculates the difference of the approximate geocentric,
apparent azimuth of Sun and Moon (delta),
at which the Sun is used as the reference point,
in degrees and arcminutes
as it happen at civil midnight time.
|
|
| ||
B
| o
| Calculates the difference of the approximate topocentric,
apparent elevation of Sun and Moon (delta),
at which the Sun is used as the reference point,
in degrees and arcminutes
as it happen at standard rise time of the Sun.
See Standard rise time of the Sun,
for further details.
|
|
| ||
B
| s
| Calculates the difference of the approximate topocentric,
apparent elevation of Sun and Moon (delta),
at which the Sun is used as the reference point,
in degrees and arcminutes
as it happen at standard set time of the Sun.
See Standard set time of the Sun,
for further details.
|
|
| ||
C
| o
| Calculates the difference of the approximate topocentric,
apparent azimuth of Sun and Moon (delta),
at which the Sun is used as the reference point,
in degrees and arcminutes
as it happen at standard rise time of the Sun.
See Standard rise time of the Sun,
for further details.
|
|
| ||
C
| s
| Calculates the difference of the approximate topocentric,
apparent azimuth of Sun and Moon (delta),
at which the Sun is used as the reference point,
in degrees and arcminutes
as it happen at standard set time of the Sun.
See Standard set time of the Sun,
for further details.
|
|
| ||
D
| o
| Calculates the difference of the approximate geocentric,
apparent elevation of Sun and Moon (delta),
at which the Sun is used as the reference point,
in degrees and arcminutes
as it happen at standard rise time of the Sun.
See Standard rise time of the Sun,
for further details.
|
|
| ||
D
| s
| Calculates the difference of the approximate geocentric,
apparent elevation of Sun and Moon (delta),
at which the Sun is used as the reference point,
in degrees and arcminutes
as it happen at standard set time of the Sun.
See Standard set time of the Sun,
for further details.
|
|
| ||
E
| o
| Calculates the difference of the approximate geocentric,
apparent azimuth of Sun and Moon (delta),
at which the Sun is used as the reference point,
in degrees and arcminutes
as it happen at standard rise time of the Sun.
See Standard rise time of the Sun,
for further details.
|
|
| ||
E
| s
| Calculates the difference of the approximate geocentric,
apparent azimuth of Sun and Moon (delta),
at which the Sun is used as the reference point,
in degrees and arcminutes
as it happen at standard set time of the Sun.
See Standard set time of the Sun,
for further details.
|
|
| ||
F
| o, s
| Calculates the difference of the approximate
astronomical midnight times of Sun and Moon (delta),
at which the Sun is used as the reference point,
as time value in hours and minutes
as it happen at astronomical midnight time of the Sun.
Results with a negative sign signify that the astronomical midnight time
of the Sun is earlier than the astronomical midnight time of the Moon;
thus the solar midnight is before the lunar midnight.
Results with a positive sign signify that the astronomical midnight time
of the Sun is later than the astronomical midnight time of the Moon;
thus the solar midnight is after the lunar midnight.
See Astronomical midnight time of the Sun,
and
Astronomical midnight time of the Moon,
for further details.
|
|
| ||
G
| o, s
| Calculates the difference of the approximate
astronomical noon times of Sun and Moon (delta),
at which the Sun is used as the reference point,
as time value in hours and minutes
as it happen at astronomical noon time of the Sun.
Results with a negative sign signify that the astronomical noon time
of the Sun is earlier than the astronomical noon time of the Moon;
thus the solar noon is before the lunar noon.
Results with a positive sign signify that the astronomical noon time
of the Sun is later than the astronomical noon time of the Moon;
thus the solar noon is after the lunar noon.
See Astronomical noon time of the Sun,
and
Astronomical noon time of the Moon,
for further details.
|
|
| ||
H
| o
| Calculates the difference of the approximate
standard rise times of Sun and Moon (delta),
at which the Sun is used as the reference point,
as time value in hours and minutes
as it happen at standard rise time of the Sun.
Results with a negative sign signify that the standard rise time
of the Sun is earlier than the standard rise time of the Moon;
thus the sunrise is before the moonrise.
Results with a positive sign signify that the standard rise time
of the Sun is later than the standard rise time of the Moon;
thus the sunrise is after the moonrise.
See Standard rise time of the Sun,
and
Standard rise time of the Moon,
for further details.
|
|
| ||
H
| s
| Calculates the difference of the approximate
standard set times of Sun and Moon (delta),
at which the Sun is used as the reference point,
as time value in hours and minutes
as it happen at standard set time of the Sun.
Results with a negative sign signify that the standard set time
of the Sun is earlier than the standard set time of the Moon;
thus the sunset is before the moonset.
Results with a positive sign signify that the standard set time
of the Sun is later than the standard set time of the Moon;
thus the sunset is after the moonset.
See Standard set time of the Sun,
and
Standard set time of the Moon,
for further details.
|
|
| ||
I
| o, s
| Calculates the approximate topocentric, apparent elevation
of the Sun in degrees and arcminutes
as it happen at astronomical midnight time of the Sun
(topocentric midnight height).
See Astronomical midnight time of the Sun,
for further details.
|
|
| ||
J
| o, s
| Calculates the approximate topocentric, apparent elevation
of the Sun in degrees and arcminutes
as it happen at astronomical midnight time of the Sun
(topocentric midnight height).
See Astronomical noon time of the Sun,
for further details.
|
|
| ||
K
| o
| Calculates the approximate topocentric, apparent elevation
of the Sun in degrees and arcminutes
as it happen at standard rise time of the Sun
(topocentric rise height).
See Standard rise time of the Sun,
for further details.
|
|
| ||
K
| s
| Calculates the approximate topocentric, apparent elevation
of the Sun in degrees and arcminutes
as it happen at standard set time of the Sun
(topocentric set height).
See Standard set time of the Sun,
for further details.
|
|
| ||
L
| o
| Calculates the approximate topocentric, apparent azimuth
of the Sun in degrees and arcminutes
as it happen at standard rise time of the Sun
(topocentric rise azimuth). The horizontal angular distance
between the topocentric rise azimuth and the East direction is also
known as the topocentric morning width of the Sun.
See Standard rise time of the Sun,
for further details.
|
|
| ||
L
| s
| Calculates the approximate topocentric, apparent azimuth
of the Sun in degrees and arcminutes
as it happen at standard set time of the Sun
(topocentric set azimuth). The horizontal angular distance
between the topocentric set azimuth and the West direction is also
known as the topocentric evening width of the Sun.
See Standard set time of the Sun,
for further details.
|
|
| ||
M
| o, s
| Calculates the approximate geocentric, apparent elevation
of the Sun in degrees and arcminutes
as it happen at astronomical midnight time of the Sun
(geocentric midnight height).
See Astronomical midnight time of the Sun,
for further details.
|
|
| ||
N
| o, s
| Calculates the approximate geocentric, apparent elevation
of the Sun in degrees and arcminutes
as it happen at astronomical midnight time of the Sun
(geocentric midnight height).
See Astronomical noon time of the Sun,
for further details.
|
|
| ||
O
| o
| Calculates the approximate geocentric, apparent elevation
of the Sun in degrees and arcminutes
as it happen at standard rise time of the Sun
(geocentric rise height).
See Standard rise time of the Sun,
for further details.
|
|
| ||
O
| s
| Calculates the approximate geocentric, apparent elevation
of the Sun in degrees and arcminutes
as it happen at standard set time of the Sun
(geocentric set height).
See Standard set time of the Sun,
for further details.
|
|
| ||
P
| o
| Calculates the approximate geocentric, apparent azimuth
of the Sun in degrees and arcminutes
as it happen at standard rise time of the Sun
(geocentric rise azimuth). The horizontal angular distance
between the geocentric rise azimuth and the East direction is also
known as the geocentric morning width of the Sun.
See Standard rise time of the Sun,
for further details.
|
|
| ||
P
| s
| Calculates the approximate geocentric, apparent azimuth
of the Sun in degrees and arcminutes
as it happen at standard set time of the Sun
(geocentric set azimuth). The horizontal angular distance
between the geocentric set azimuth and the West direction is also
known as the geocentric evening width of the Sun.
See Standard set time of the Sun,
for further details.
|
|
| ||
Q
| o
| Calculates the approximate time when the length of the shadow cast
by a vertical pole in the forenoon is equal the length of the pole.
Nevertheless, the minimum length of the shadow is subtracted from the
length of the shadow before comparing it with the length of the pole.
See Fixed dates option --adjust-value=argument,
how to change the shadow length factor.
|
|
| ||
Q
| s
| Calculates the approximate time when the length of the shadow cast by
a vertical pole in the afternoon is equal the length of the pole.
Nevertheless, the minimum length of the shadow is subtracted from the
length of the shadow before comparing it with the length of the pole.
People of Islamic faith, and that the people holding the Shafi
school of jurisprudence, normally pray for the third time on the day
at this clocktime, or some minutes later. These people commonly use
the term Asr for this prayer time.
See Astronomical noon time of the Sun,
for more information. And note
Fixed dates option --adjust-value=argument,
how to change the shadow length factor.
|
|
| ||
Q
| u
| Calculates the approximate period while the center of the Sun
is above a reference altitude, at which the length of the shadow cast
by a vertical pole is of single or shorter length than the pole itself.
|
|
| ||
Q
| z
| Calculates the approximate period while the center of the Sun
is below a reference altitude, at which a vertical pole either casts no
shadow anymore, or casts a shadow that is longer than the single length
of the pole itself.
|
|
| ||
R
| o
| Calculates the approximate time when the length of the shadow cast
by a vertical pole at forenoon is twice the length of the pole.
Nevertheless, the minimum length of the shadow is subtracted from the
length of the shadow before comparing it with the length of the pole.
See Fixed dates option --adjust-value=argument,
how to change the shadow length factor.
|
|
| ||
R
| s
| Calculates the approximate time when the length of the shadow cast by
a vertical pole in the afternoon is twice the length of the pole.
Nevertheless, the minimum length of the shadow is subtracted from the
length of the shadow before comparing it with the length of the pole.
People of Islamic faith, and that the people holding the Hanafi
school of jurisprudence, normally pray for the third time on the day
at this clocktime, or some minutes later. These people commonly use
the term Asr for this prayer time.
See Astronomical noon time of the Sun,
for more information. And note
Fixed dates option --adjust-value=argument,
how to change the shadow length factor.
|
|
| ||
R
| u
| Calculates the approximate period while the center of the Sun
is above a reference altitude, at which the length of the shadow cast
by a vertical pole is of double or shorter length than the pole itself.
|
|
| ||
R
| z
| Calculates the approximate period while the center of the Sun
is below a reference altitude, at which a vertical pole either casts no
shadow anymore, or casts a shadow that is longer than twice the length
of the pole itself.
|
If no mode is given, Gcal automatically uses that mode, which is enabled by the mode character ‘5’. If a mode character is given that is not according to one of the ‘0’...‘9’, ‘a’...‘z’ and ‘A’...‘R’ characters, Gcal also automatically uses that mode, which is enabled by the mode character ‘5’.
Gcal represents the Sun oriented special texts depending on the selected mode using the following types and styles:
.n... format by default.
A ‘*’ character that is directly given before some mode characters
causes Gcal to represent the value for another quantity. For the mode
characters, which
If definite events happen, Gcal displays special event oriented texts instead of using the previously described representations. See Event texts of the Sun oriented special texts, where you can find the event oriented texts that are created for clocktime values, which are schematically and analogously used for the type of representation as it is described here.
+|-n.n... format by default.
A ‘*’ character that is directly given before a mode character
causes Gcal not to represent such values using another style.
If definite events happen, Gcal displays special event oriented texts instead of using the previously described representations. See Event texts of the Sun oriented special texts, where you can find the event oriented texts that are created for clocktime values, which are schematically and analogously used for the type of representation as it is described here.
:mm 24-hour format by default.
A ‘*’ character that is directly given before a mode character
causes Gcal to represent the clocktime value using the 12-hour
format, thus to provide it with a time suffix.
See Actual local time %t[argument] special text,
for more details about the above mentioned time value template.
If definite events happen, Gcal displays special event oriented texts instead of using the previously described representations:
??:?? text will be
created instead of the clocktime text.
**:** text will
be created instead of the clocktime text.
++:++ text will be created instead of the
clocktime text.
--:-- text will be created instead of the
clocktime text.
hmm' format by default.
A ‘*’ character that is directly given before a mode character
causes Gcal to represent the time value using another style, and that in
decimal hours, i.e. in the hh.h... format.
If definite events happen, Gcal displays special event oriented texts instead of using the previously described representations. See Event texts of the Sun oriented special texts, where you can find the event oriented texts that are created for clocktime values, which are schematically and analogously used for the type of representation as it is described here.
+|-hhhmm' format by default.
A ‘*’ character that is directly given before a mode character
causes Gcal to represent the time value using another style, and that in
decimal hours, i.e. in the +|-hh.h... format.
If definite events happen, Gcal displays special event oriented texts instead of using the previously described representations. See Event texts of the Sun oriented special texts, where you can find the event oriented texts that are created for clocktime values, which are schematically and analogously used for the type of representation as it is described here.
dmm' format by default.
A ‘*’ character that is directly given before a mode character causes
Gcal to represent the angular value using another style, and that in
decimal degrees, i.e. in the ddd.d... format.
If definite events happen, Gcal displays special event oriented texts instead of using the previously described representations. See Event texts of the Sun oriented special texts, where you can find the event oriented texts that are created for clocktime values, which are schematically and analogously used for the type of representation as it is described here.
+|-ddddmm' format by default.
A ‘*’ character that is directly given before a mode character causes
Gcal to represent the angular value using another style, and that in
decimal degrees, i.e. in the +|-ddd.d...
format.
If definite events happen, Gcal displays special event oriented texts instead of using the previously described representations. See Event texts of the Sun oriented special texts, where you can find the event oriented texts that are created for clocktime values, which are schematically and analogously used for the type of representation as it is described here.
After the optional style and mode characters, the latitude and longitude of the geographic co-ordinates follows, for which the calculations must be made. They must be conform the ISO-6709:1983 standard representation of latitude and longitude for geographic point locations, so that the co-ordinate has to be declared like this:
+ for North and on the equator,
- for South of the equator.)
+|-dd[.dd]+|-ddmm[.mm]+|-ddmmss[.ss]+ for East and on the prime meridian (Greenwich),
- for West of Greenwich and up to the 180th meridian.)
+|-ddd[.dd]+|-dddmm[.mm]+|-dddmmss[.ss]+
for heights above and on the sea level, - for heights below
the sea level.)
+|-n[n[n[n]]]]-9999...+9999 (1...4 digits)
All components of the co-ordinates must have leadings zeroes in case they have
less digits than the templates shown above. Declared decimal seconds are not
respected by Gcal. Heights which have a negative sign remain unrespected
if Gcal determinates Sun and Moon data and times, respectively. In such a
case, Gcal always uses the height +0. Latitude and longitude
co-ordinates, and the height of the observer's location are connected without
any separating characters, like ‘+40-075+61’, ‘+401213.1-0750015.1’
or ‘+40.20361-075.00417+0061’. See the pertinent literature
for more details.
A time value [+|-]mmmm|hh:[mm],
which is separated by a ‘,’ character, may trail the co-ordinate. Such
a time value informs Gcal, about how many minutes mmmm respectively
hours hh and minutes mm the geographic location is displaced
from Universal time (UTC/GMT). This time displacement value defines
the timezone, which is actually valid for this location. If summer- and
wintertimes are respected for the location, you should include that change
in time into the timezone value for the period in which the summertime is
valid, by which the clock is put on during the summertime period — such
a change is either subtracted from the timezone value for locations West
of the prime meridian (Greenwich), or it is added for locations East of
the prime meridian, because Gcal is actually unable to perform such
operations automatically!
See Actual local time %t[argument] special text,
for more details about the above mentioned time value template.
If no time displacement value is specified for a given co-ordinate, Gcal
assumes a time displacement value of 0, which is equal to the actual
Universal time (UTC/GMT).
The following table informs you about which type of representation is caused by a mode. The previously defined numbering scheme, as it has been used for the introduction of the types of representations, is used as key value in the column that holds the type of representation. The table also contains a column that shows whether a mode enables dynamical values, i.e. values that are depending on the respective clocktime (if you use the --time-offset=argument option, you can change the respective clocktime that is used for calculating such values). In a next table column, it is listed whether the given co-ordinate of the location influences the determination of a value, and the last column of the table gives you the information whether a given timezone value affects the values determination:
And now some examples to these special texts:
The text ‘Sunrise at %o+5158+00738,120 in MS, BRD’ will be expanded to
==> ‘Sunrise at 05:16 in MS, BRD’, in case the actual system date is the 1st June 1998.
The text ‘Sunset at %s*5+5158+00738,120 in MS, BRD’ will be expanded to
==> ‘Sunset at 09:39pm in MS, BRD’, in case the actual system date is the 1st June 1998.
The text ‘Sun visible %u5+5158+00738,120 in MS, BRD’ will be expanded to
==> ‘Sun visible 16h24' in MS, BRD’, in case the actual system date is the 1st June 1998.
The text ‘Sun non-visible %z*+5158+00738,120 in MS, BRD’ will be expanded to
==> ‘Sun non-visible 7.607 in MS, BRD’, in case the actual system date is the 1st June 1998.
The text ‘Sun azimuth 0 o'clock=%s*a+5158+00738,120 in MS, BRD’ will be expanded to
==> ‘Sun azimuth 0 o'clock=339d16' in MS, BRD’, in case the actual system date is the 1st June 1998.
The text ‘Equation of time %ot+00+000=%o*w+00+000,120 BRD’ will be expanded to
==> ‘Equation of time +16h00'=+00h02'13.201" BRD’, in case you call Gcal with the --time-offset=16: and --precise options and the actual system date is the 1st June 1998.
The text ‘Julian date at %ot+00+000 =%ou+00+000’ will be expanded to
==> ‘Julian date at +10h15'=2450965.927’, in case you call Gcal with the --time-offset=10:15 option and the actual system date is the 1st June 1998.
Here is a list that reports about the used reference systems in a short manner, describes other aspects that are unmentioned now, and informs about the lacks and limitations that are existing for the Sun oriented special texts:
Please also note the following references:
All Sun oriented special texts must always be trailed by a whitespace character which is removed in output!
%[format]?argument special texts
%[format]([*][mode]ISO-6709:1983-co-ordinate[,[+|-]mmmm|hh:[mm]]
references the approximate time of moonrise by default,
%[format])[*][mode]ISO-6709:1983-co-ordinate[,[+|-]mmmm|hh:[mm]]
references the approximate time of moonset by default,
%[format][[*][mode]ISO-6709:1983-co-ordinate[,[+|-]mmmm|hh:[mm]]
references the approximate period of visibility of the Moon
(lunar day length) by default,
%[format]][*][mode]ISO-6709:1983-co-ordinate[,[+|-]mmmm|hh:[mm]]
references the approximate period of non-visibility of the Moon
(lunar night length) by default.
All these special texts can be used for at pleasure any geographic point location, i.e. it is possible to determine different astronomical values for any location on the globe, and that for at pleasure any clocktime with a resolution of a single minute within the period of the years AD 1 until AD 9999, that is respected by Gcal.
The selection which value has to be calculated by these special texts is done by specifying the mode part of the preceding argument. Actually, exactly 61 different modes can be used that are represented by the ‘0’...‘9’, ‘a’...‘z’ and ‘A’...‘Y’ characters, and which create different kind of results that are depending on the special text used. First of all, here is a table in which all usable modes are described and explained sufficiently. You can also see from this table, which Moon oriented special text or texts are corresponding to which mode, i.e. cause the determination of an astronomical value as it is described in the table:
| Mode | Special text | Description
|
|
| ||
0
| (, )
| Calculates the approximate midnight time of the Moon.
The astronomical midnight time of the Moon is at that clocktime, when the
Moon holds an azimuth (horizontal angular distance between the vertical
circle, that passes the Moon, and the North point) of either precisely
0 degrees of precisely 180 degrees, which depends on the season and
the geographical location.
At that clocktime, the Moon is close its lowest culmination point,
i.e. close the lowest point below or above the horizontal plane the
Moon transits during this day.
Nevertheless, there is exactly one day during a synodic month (or
lunation) —i.e. the mean time between two consecutive conjunctions
(or New Moon phases)— at which no lunar midnight happens, because the Moon
revolves the Earth within 24 hours and 50 minutes on the average — which
also means, that the Moon rises on the average 50 minutes later each day.
|
|
| ||
1
| (, )
| Calculates the approximate noon time of the Moon.
The astronomical noon time of the Moon is at that clocktime, when
the Moon holds an azimuth of either precisely 180 degrees of precisely
0 degrees, which depends on the season and the geographical location.
At that clocktime, the Moon is close its highest culmination point,
i.e. close the highest point above or below the horizontal plane the
Moon transits during this day.
Nevertheless, there is exactly one day during a synodic month at which
no lunar noon happens.
|
|
| ||
2
| (
| Calculates the approximate time when the center of the Moon
passes a reference altitude which is between about 54 and 61 arcminutes
above a mathematical-geocentric horizon before lunar noon time;
thus rising.
A mathematical horizon is a purely geometrically-built horizon which
disregards the phenomenon of refraction as it arises in reality by the
influence of the Earth's atmosphere. A geocentrical horizon is the
horizontal plane that passes through the Earth's center, orthogonal
to the observer's local vertical. In the further context, the shorter
term mathematical horizon is used which actually means the
mathematical-geocentric horizon.
The above mentioned reference altitude is computed from the
value of the Moon's parallax as it appear at that clocktime.
Nevertheless, there is exactly one day during a synodic month
at which no such moonrise happens.
|
|
| ||
2
| )
| Calculates the approximate time when the center of the Moon
passes a reference altitude which is between about 54 and 61 arcminutes
above a mathematical horizon after lunar noon time;
thus setting.
The above mentioned reference altitude is computed from the
value of the Moon's parallax as it appear at that clocktime.
Nevertheless, there is exactly one day during a synodic month
at which no such moonset happens.
|
|
| ||
2
| [
| Calculates the approximate period while the center of the Moon
is above a reference altitude which is between about 54 and 61 arcminutes
above a mathematical horizon; thus is visible.
|
|
| ||
2
| ]
| Calculates the approximate period while the center of the Moon
is below a reference altitude which is between about 54 and 61 arcminutes
above a mathematical horizon; thus is non-visible.
|
|
| ||
3
| (
| Calculates the approximate time when the upper limb of the Moon
passes a reference altitude which is between about 54 and 61 arcminutes
above a mathematical horizon before lunar noon time; thus rising.
The above mentioned reference altitude is computed from the respective
values of the Moon's semidiameter and Moon's parallax as they appear
at that clocktime.
If the reference altitude that is referring to the Moon's upper limb is
converted to a reference altitude that is referring to the Moon's center,
this results in a value which is between about 39 and 44 arcminutes
above the geocentric horizon.
Nevertheless, there is exactly one day during a synodic month at which
no such moonrise happens.
|
|
| ||
3
| )
| Calculates the approximate time when the upper limb of the Moon
passes a reference altitude which is between about 54 and 61 arcminutes
above a mathematical horizon after lunar noon time; thus setting.
The above mentioned reference altitude is computed from the respective
values of the Moon's semidiameter and Moon's parallax as they appear
at that clocktime.
Nevertheless, there is exactly one day during a synodic month at which
no such moonset happens.
|
|
| ||
3
| [
| Calculates the approximate period while the upper limb of the Moon
is above a reference altitude which is between about 54 and 61 arcminutes
above a mathematical horizon; thus is visible.
|
|
| ||
3
| ]
| Calculates the approximate period while the upper limb of the Moon
is below a reference altitude which is between about 54 and 61 arcminutes
above a mathematical horizon; thus is non-visible.
|
|
| ||
4
| (
| Calculates the approximate time when the center of the Moon
passes a reference altitude which is between about 20 and 27 arcminutes
above the geocentric horizon before lunar noon time; thus rising.
The phenomenon of refraction is already respected in this as it arises in
reality by the influence of the Earth's atmosphere, and that with the standard
value of 34 arcminutes, which can indirectly be changed by using the
--atmosphere option.
Fixed dates option --atmosphere=air-pressure[,temperature],
how to change the base data of the atmosphere, so that the atmospheric
conditions as defined by it are used to calculate the amount of refraction.
The above mentioned reference altitude is computed from the respective
values of the Moon's parallax and (standard) refraction as they appear
at that clocktime.
Nevertheless, there is exactly one day during a synodic month at which
no such moonrise happens.
|
|
| ||
4
| )
| Calculates the approximate time when the center of the Moon
passes a reference altitude which is between about 20 and 27 arcminutes
above the geocentric horizon after lunar noon time; thus setting.
The phenomenon of refraction is already respected in this as it arises in
reality by the influence of the Earth's atmosphere, and that with the standard
value of 34 arcminutes, which can indirectly be changed by using the
--atmosphere option.
The above mentioned reference altitude is computed from the respective
values of the Moon's parallax and (standard) refraction as they appear
at that clocktime.
Nevertheless, there is exactly one day during a synodic month at which
no such moonset happens.
|
|
| ||
4
| [
| Calculates the approximate period while the center of the Moon
is above a reference altitude which is between about 20 and 27 arcminutes
above the geocentric horizon; thus is visible.
|
|
| ||
4
| ]
| Calculates the approximate period while the center of the Moon
is below a reference altitude which is between about 20 and 27 arcminutes
above the geocentric horizon; thus is non-visible.
|
|
| ||
5
| (
| Calculates the approximate time when the upper limb of the Moon
passes a reference altitude which is between about 20 and 27 arcminutes
above the geocentric horizon before lunar noon time; thus rising.
This kind of rise time calculation is done according to the standard
calculation method as it is commonly used internationally.
The phenomenon of refraction is already respected in this as it arises in
reality by the influence of the Earth's atmosphere, and that with the standard
value of 34 arcminutes, which can indirectly be changed by using the
--atmosphere option.
Fixed dates option --atmosphere=air-pressure[,temperature],
how to change the base data of the atmosphere, so that the atmospheric
conditions as defined by it are used to calculate the amount of refraction.
The above mentioned reference altitude is computed from the respective
values of the Moon's semidiameter, Moon's parallax and (standard) refraction
as they appear at that clocktime.
If the reference altitude that is referring to the Moon's upper limb is
converted to a reference altitude that is referring to the Moon's center,
this results in a value which is between about 5 and 10 arcminutes above
the geocentric horizon.
Nevertheless, there is exactly one day during a synodic month at which
no such moonrise happens.
|
|
| ||
5
| )
| Calculates the approximate time at which the upper limb of the Moon
passes a reference altitude which is between about 20 and 27 arcminutes
above the geocentric horizon after lunar noon time; thus setting.
This kind of set time calculation is done according to the standard
calculation method as it is commonly used internationally.
The phenomenon of refraction is already respected in this as it arises in
reality by the influence of the Earth's atmosphere, and that with the standard
value of 34 arcminutes, which can indirectly be changed by using the
--atmosphere option.
The above mentioned reference altitude is computed from the respective
values of the Moon's semidiameter, Moon's parallax and (standard) refraction
as they appear at that clocktime.
Nevertheless, there is exactly one day during a synodic month at which
no such moonset happens.
|
|
| ||
5
| [
| Calculates the approximate period while the upper limb of the Moon
is above a reference altitude which is between about 20 and 27 arcminutes
above the geocentric horizon; thus is visible.
This kind of visibility period calculation is done according to the standard
calculation method as it is commonly used internationally.
|
|
| ||
5
| ]
| Calculates the approximate period while the upper limb of the Moon
is below a reference altitude which is between about 20 and 27 arcminutes
above the geocentric horizon; thus is non-visible.
This kind of non-visibility period calculation is done according to the
standard calculation method as it is commonly used internationally.
|
|
| ||
6
| (, )
| Calculates the approximate topocentric, apparent
horizontal parallax of the Moon in degrees and arcminutes
as it happen at civil midnight time.
The Moon's parallax states the diameter of the Earth as it is seen from
the surface of the Moon.
Observations of celestial objects that are done from the surface of the
Earth yield in topocentrically based data. The locations of the celestial
bodies are often at another place if the data is topocentrically determined
instead of determine it geocentrically, i.e. at the fictitious
center of the Earth.
This is mainly caused by the refraction, which raises a celestial body to
another location as it is been in reality. Because the terrestrial globe
flattens towards the pole caps and therefore cannot be taken as an ideally
shaped sphere, the individual Earth radius between the observer's location
and the center of the Earth also affects the computation of
topocentrically based data.
|
|
| ||
7
| (, )
| Calculates the approximate topocentric, apparent semidiameter
of the Moon in degrees and arcminutes
as it happen at civil midnight time.
|
|
| ||
8
| (, )
| Calculates the approximate topocentric, apparent brightness
of the Moon in magnitude units
as it happen at civil midnight time.
The magnitude (Latin term magnitudo, abbreviated m) is used
to define the brightness of a star, and is a non-metrical value. The
difference between two consecutive magnitudes is 1 to 2.512. Therefore,
a star with the brightness of 1m is 2.512 times brighter than
a star of 2m. A negative magnitude denotes a very bright star,
for example almost -27m for the Sun, whereas the hardly visible
planet Pluto has a magnitude of a bit more than +14m. The Full
Moon has a visual brightness of about -12m.55.
|
|
| ||
9
| (, )
| Calculates the approximate topocentric, apparent phase angle
of the Moon in range 0.0...1.0
as it happen at civil midnight time.
|
|
| ||
a
| (, )
| Calculates the approximate topocentric, apparent elevation
of the Moon, thus the vertical angular distance between the Moon's center
and the horizon, in degrees and arcminutes
as it happen at civil midnight time.
Results with a negative sign signify that the Moon's center is below the
horizon at the moment, and results with a positive sign mean that the
momentary center of the Moon is above the horizon.
|
|
| ||
b
| (, )
| Calculates the approximate topocentric, apparent azimuth
of the Moon in degrees and arcminutes
as it happen at civil midnight time.
|
|
| ||
c
| (, )
| Calculates the approximate topocentric, apparent declination
of the Moon, thus the vertical angular distance between the Moon's center
and the celestial equator, in degrees and arcminutes
as it happen at civil midnight time.
Results with a negative sign signify that the Moon's center is below the
celestial equator at the moment, and results with a positive sign mean that
the momentary center of the Moon is above the celestial equator.
|
|
| ||
d
| (, )
| Calculates the approximate topocentric, apparent ecliptic longitude
of the Moon, thus the horizontal angular distance between the Moon's center and
the vernal equinox point on the ecliptic (the zodiacal line or Sun's
orbit),
in degrees and arcminutes
as it happen at civil midnight time.
|
|
| ||
e
| (, )
| Calculates the approximate topocentric, apparent ecliptic latitude
of the Moon, thus the vertical angular distance between the Moon's center
and the ecliptic (zodiacal line/Sun's orbit),
in degrees and arcminutes
as it happen at civil midnight time.
Results with a negative sign signify that the Moon's center is North
of the ecliptic at the moment, and results with a positive sign mean
that the momentary center of the Moon is South of the ecliptic.
|
|
| ||
f
| (, )
| Calculates the approximate topocentric, apparent right ascension
of the Moon, thus the horizontal angular distance between the Moon's center
and the hour circle that passes through the vernal equinox point on the
ecliptic, as time value in hours and minutes
as it happen at civil midnight time.
|
|
| ||
g
| (, )
| Calculates the approximate topocentric, apparent distance
of the Moon from the Earth in mean Earth equator radii
as it happen at civil midnight time.
The mean radius of Earth at the equator is about 6,378.137 kilometer.
|
|
| ||
h
| (, )
| Calculates the approximate topocentric, apparent elongation
of the Moon, thus the horizontal angular distance between the Moon's center
and the Sun's center,
in degrees and arcminutes
as it happen at civil midnight time.
|
|
| ||
i
| (, )
| Calculates the approximate refraction of the Earth's atmosphere
in degrees and arcminutes
as it happen at civil midnight time.
|
|
| ||
j
| (, )
| Calculates the approximate geocentric, apparent
horizontal parallax of the Moon in degrees and arcminutes
as it happen at civil midnight time.
|
|
| ||
k
| (, )
| Calculates the approximate geocentric, apparent semidiameter
of the Moon in degrees and arcminutes
as it happen at civil midnight time.
|
|
| ||
l
| (, )
| Calculates the approximate geocentric, apparent brightness
of the Moon in magnitude units
as it happen at civil midnight time.
|
|
| ||
m
| (, )
| Calculates the approximate geocentric, apparent phase angle
of the Moon in range 0.0...1.0
as it happen at civil midnight time.
|
|
| ||
n
| (, )
| Calculates the approximate geocentric, apparent elevation
of the Moon in degrees and arcminutes
as it happen at civil midnight time.
Results with a negative sign signify that the Moon's center is below the
horizon at the moment, and results with a positive sign mean that the
momentary center of the Moon is above the horizon.
|
|
| ||
o
| (, )
| Calculates the approximate geocentric, apparent azimuth
of the Moon in degrees and arcminutes
as it happen at civil midnight time.
|
|
| ||
p
| (, )
| Calculates the approximate geocentric, apparent declination
of the Moon in degrees and arcminutes
as it happen at civil midnight time.
Results with a negative sign signify that the Moon's center is below the
celestial equator at the moment, and results with a positive sign mean that
the momentary center of the Moon is above the celestial equator.
|
|
| ||
q
| (, )
| Calculates the approximate geocentric, apparent ecliptic longitude
of the Moon in degrees and arcminutes
as it happen at civil midnight time.
|
|
| ||
r
| (, )
| Calculates the approximate geocentric, apparent ecliptic latitude
of the Moon in degrees and arcminutes
as it happen at civil midnight time.
Results with a negative sign signify that the Moon's center is North
of the ecliptic at the moment, and results with a positive sign mean
that the momentary center of the Moon is South of the ecliptic.
|
|
| ||
s
| (, )
| Calculates the approximate geocentric, apparent right ascension
of the Moon as time value in hours and minutes
as it happen at civil midnight time.
|
|
| ||
t
| (, )
| Calculates the approximate geocentric, apparent distance
of the Moon from the Earth in mean Earth equator radii
as it happen at civil midnight time.
|
|
| ||
u
| (, )
| Calculates the approximate geocentric, apparent elongation
of the Moon in degrees and arcminutes
as it happen at civil midnight time.
|
|
| ||
v
| (, )
| Calculates the approximate delta-t in seconds
as it happen at civil midnight time.
Delta-t is the difference between the Terrestrial Dynamical time
(abbreviated by TDT), that was formerly known as Ephemeris
time (abbreviated by ET), and the Universal time (UT).
Thus, ‘delta-t == TDT - UT’.
|
|
| ||
w
| (, )
| Calculates the approximate, apparent location oriented
sidereal time (local sidereal time (LAST),
also known as local star time) in hours and minutes
as it happen at civil midnight time.
A star day is the period between two consecutive upper culminations
of the vernal equinox point on the ecliptic in the meridian of the observer's
location. Therefore, the local star time is the momentary period,
which is past between the last upper culmination of the vernal equinox
point in the meridian of the observer's location (the momentary hour angle
of the vernal equinox point), thus the right ascension of the stars in the
observer's meridian at the moment.
|
|
| ||
x
| (, )
| Outputs the base time as time value in hours and minutes,
for which the dynamical, i.e. depending on the respective clocktime,
astronomical data and times of the Moon are calculated.
Without a given --time-offset=argument option,
the astronomical data and times of the Moon are always calculated
for 0 o'clock Universal time (UTC/GMT).
See Calendar option --time-offset=argument,
for further details.
|
|
| ||
y
| (, )
| Calculates the approximate Julian date in days
as it happen at civil midnight time.
See Julian day number,
for further information about the Julian date.
|
|
| ||
z
| (, )
| Calculates the approximate Julian Ephemeris date,
thus a Julian date that is corrected by delta-t, in days
as it happen at civil midnight time.
|
|
| ||
A
| (, )
| Calculates the difference of the approximate topocentric,
apparent elevation of Moon and Sun (delta),
at which the Moon is used as the reference point,
in degrees and arcminutes
as it happen at civil midnight time.
Results with a negative sign signify that the momentary center of the Moon is
at an elevation that is below the momentary elevation of the Sun's center;
thus the Moon is lower than the Sun.
Results with a positive sign signify that the momentary center of the Moon is
at an elevation that is above the momentary elevation of the Sun's center;
thus the Moon is higher than the Sun.
|
|
| ||
B
| (, )
| Calculates the difference of the approximate topocentric,
apparent azimuth of Moon and Sun (delta),
at which the Moon is used as the reference point,
in degrees and arcminutes
as it happen at civil midnight time.
The result specifies the horizontal angular distance, by which the momentary
center of the Moon is distant from the momentary Sun's center, and that
measured at the vertical circles that pass the Moon and the North point
and the Sun and the North point.
Results with a negative sign signify that the Sun is to the right
(clockwise) of the Moon if one looks to the Moon — or alternatively
expressed, that the Moon is to the left (anti-clockwise) of the Sun.
Results with a positive sign signify that the Sun is to the left
(anti-clockwise) of the Moon if one looks to the Moon — or alternatively
expressed, that the Moon is to the right (clockwise) of the Sun.
|
|
| ||
C
| (, )
| Calculates the difference of the approximate geocentric,
apparent elevation of Moon and Sun (delta),
at which the Moon is used as the reference point,
in degrees and arcminutes
as it happen at civil midnight time.
|
|
| ||
D
| (, )
| Calculates the difference of the approximate geocentric,
apparent azimuth of Moon and Sun (delta),
at which the Moon is used as the reference point,
in degrees and arcminutes
as it happen at civil midnight time.
|
|
| ||
E
| (
| Calculates the difference of the approximate topocentric,
apparent elevation of Moon and Sun (delta),
at which the Moon is used as the reference point,
in degrees and arcminutes
as it happen at standard rise time of the Moon.
See Standard rise time of the Moon,
for further details.
|
|
| ||
E
| )
| Calculates the difference of the approximate topocentric,
apparent elevation of Moon and Sun (delta),
at which the Moon is used as the reference point,
in degrees and arcminutes
as it happen at standard set time of the Moon.
See Standard set time of the Moon,
for further details.
|
|
| ||
F
| (
| Calculates the difference of the approximate topocentric,
apparent azimuth of Moon and Sun (delta),
at which the Moon is used as the reference point,
in degrees and arcminutes
as it happen at standard rise time of the Moon.
See Standard rise time of the Moon,
for further details.
|
|
| ||
F
| )
| Calculates the difference of the approximate topocentric,
apparent azimuth of Moon and Sun (delta),
at which the Moon is used as the reference point,
in degrees and arcminutes
as it happen at standard set time of the Moon.
See Standard set time of the Moon,
for further details.
|
|
| ||
G
| (
| Calculates the difference of the approximate geocentric,
apparent elevation of Moon and Sun (delta),
at which the Moon is used as the reference point,
in degrees and arcminutes
as it happen at standard rise time of the Moon.
See Standard rise time of the Moon,
for further details.
|
|
| ||
G
| )
| Calculates the difference of the approximate geocentric,
apparent elevation of Moon and Sun (delta),
at which the Moon is used as the reference point,
in degrees and arcminutes
as it happen at standard set time of the Moon.
See Standard set time of the Moon,
for further details.
|
|
| ||
H
| (
| Calculates the difference of the approximate geocentric,
apparent azimuth of Moon and Sun (delta),
at which the Moon is used as the reference point,
in degrees and arcminutes
as it happen at standard rise time of the Moon.
See Standard rise time of the Moon,
for further details.
|
|
| ||
H
| )
| Calculates the difference of the approximate geocentric,
apparent azimuth of Moon and Sun (delta),
at which the Moon is used as the reference point,
in degrees and arcminutes
as it happen at standard set time of the Moon.
See Standard set time of the Moon,
for further details.
|
|
| ||
I
| (, )
| Calculates the difference of the approximate
astronomical midnight times of Moon and Sun (delta),
at which the Moon is used as the reference point,
as time value in hours and minutes
as it happen at astronomical midnight time of the Moon.
Results with a negative sign signify that the astronomical midnight time
of the Moon is earlier than the astronomical midnight time of the Sun;
thus the lunar midnight is before the solar midnight.
Results with a positive sign signify that the astronomical midnight time
of the Moon is later than the astronomical midnight time of the Sun;
thus the lunar midnight is after the solar midnight.
See Astronomical midnight time of the Moon,
and
Astronomical midnight time of the Sun,
for further details.
|
|
| ||
J
| (, )
| Calculates the difference of the approximate
astronomical noon times of Moon and Sun (delta),
at which the Moon is used as the reference point,
as time value in hours and minutes
as it happen at astronomical noon time of the Moon.
Results with a negative sign signify that the astronomical noon time
of the Moon is earlier than the astronomical noon time of the Sun;
thus the lunar noon is before the solar noon.
Results with a positive sign signify that the astronomical noon time
of the Moon is later than the astronomical noon time of the Sun;
thus the lunar noon is after the solar noon.
See Astronomical noon time of the Moon,
and
Astronomical noon time of the Sun,
for further details.
|
|
| ||
K
| (
| Calculates the difference of the approximate
standard rise times of Moon and Sun (delta),
at which the Moon is used as the reference point,
as time value in hours and minutes
as it happen at standard rise time of the Moon.
Results with a negative sign signify that the standard rise time
of the Moon is earlier than the standard rise time of the Sun;
thus the moonrise is before the sunrise.
Results with a positive sign signify that the standard rise time
of the Moon is later than the standard rise time of the Sun;
thus the moonrise is after the sunrise.
See Standard rise time of the Moon,
and
Standard rise time of the Sun,
for further details.
|
|
| ||
K
| )
| Calculates the difference of the approximate
standard set times of Moon and Sun (delta),
at which the Moon is used as the reference point,
as time value in hours and minutes
as it happen at standard set time of the Moon.
Results with a negative sign signify that the standard set time
of the Moon is earlier than the standard set time of the Sun;
thus the moonset is before the sunset.
Results with a positive sign signify that the standard set time
of the Moon is later than the standard set time of the Sun;
thus the moonset is after the sunset.
See Standard set time of the Moon,
and
Standard set time of the Sun,
for further details.
|
|
| ||
L
| (, )
| Calculates the approximate topocentric, apparent elevation
of the Moon in degrees and arcminutes
as it happen at astronomical midnight time of the Moon
(topocentric midnight height).
See Astronomical midnight time of the Moon,
for further details.
|
|
| ||
M
| (, )
| Calculates the approximate topocentric, apparent phase angle
of the Moon in range 0.0...1.0
as it happen at astronomical midnight time of the Moon
(topocentric midnight phase angle).
See Astronomical midnight time of the Moon,
for further details.
|
|
| ||
N
| (, )
| Calculates the approximate topocentric, apparent elevation
of the Moon in degrees and arcminutes
as it happen at astronomical noon time of the Moon
(topocentric noon height).
See Astronomical noon time of the Moon,
for further details.
|
|
| ||
O
| (, )
| Calculates the approximate topocentric, apparent phase angle
of the Moon in range 0.0...1.0
as it happen at astronomical noon time of the Moon
(topocentric noon phase angle).
See Astronomical noon time of the Moon,
for further details.
|
|
| ||
P
| (
| Calculates the approximate topocentric, apparent elevation
of the Moon in degrees and arcminutes
as it happen at standard rise time of the Moon
(topocentric rise height).
See Standard rise time of the Moon,
for further details.
|
|
| ||
P
| )
| Calculates the approximate topocentric, apparent elevation
of the Moon in degrees and arcminutes
as it happen at standard set time of the Moon
(topocentric set height).
See Standard set time of the Moon,
for further details.
|
|
| ||
Q
| (
| Calculates the approximate topocentric, apparent azimuth
of the Moon in degrees and arcminutes
as it happen at standard rise time of the Moon
(topocentric rise azimuth). The horizontal angular distance
between the topocentric rise azimuth and the East direction is also
known as the topocentric rise width of the Moon.
See Standard rise time of the Moon,
for further details.
|
|
| ||
Q
| )
| Calculates the approximate topocentric, apparent azimuth
of the Moon in degrees and arcminutes
as it happen at standard set time of the Moon
(topocentric set azimuth). The horizontal angular distance
between the topocentric set azimuth and the West direction is also
known as the topocentric set width of the Moon.
See Standard set time of the Moon,
for further details.
|
|
| ||
R
| (
| Calculates the approximate topocentric, apparent phase angle
of the Moon in range 0.0...1.0
as it happen at standard rise time of the Moon
(topocentric rise phase angle).
See Standard rise time of the Moon,
for further details.
|
|
| ||
R
| )
| Calculates the approximate topocentric, apparent phase angle
of the Moon in range 0.0...1.0
as it happen at standard set time of the Moon
(topocentric set phase angle).
See Standard set time of the Moon,
for further details.
|
|
| ||
S
| (, )
| Calculates the approximate geocentric, apparent elevation
of the Moon in degrees and arcminutes
as it happen at astronomical midnight time of the Moon
(geocentric midnight height).
See Astronomical midnight time of the Moon,
for further details.
|
|
| ||
T
| (, )
| Calculates the approximate geocentric, apparent phase angle
of the Moon in range 0.0...1.0
as it happen at astronomical midnight time of the Moon
(geocentric midnight phase angle).
See Astronomical midnight time of the Moon,
for further details.
|
|
| ||
U
| (, )
| Calculates the approximate geocentric, apparent elevation
of the Moon in degrees and arcminutes
as it happen at astronomical noon time of the Moon
(geocentric noon height).
See Astronomical noon time of the Moon,
for further details.
|
|
| ||
V
| (, )
| Calculates the approximate geocentric, apparent phase angle
of the Moon in range 0.0...1.0
as it happen at astronomical noon time of the Moon
(geocentric noon phase angle).
See Astronomical noon time of the Moon,
for further details.
|
|
| ||
W
| (
| Calculates the approximate geocentric, apparent elevation
of the Moon in degrees and arcminutes
as it happen at standard rise time of the Moon
(geocentric rise height).
See Standard rise time of the Moon,
for further details.
|
|
| ||
W
| )
| Calculates the approximate geocentric, apparent elevation
of the Moon in degrees and arcminutes
as it happen at standard set time of the Moon
(geocentric set height).
See Standard set time of the Moon,
for further details.
|
|
| ||
X
| (
| Calculates the approximate geocentric, apparent azimuth
of the Moon in degrees and arcminutes
as it happen at standard rise time of the Moon
(geocentric rise azimuth). The horizontal angular distance
between the geocentric rise azimuth and the East direction is also
known as the geocentric rise width of the Moon.
See Standard rise time of the Moon,
for further details.
|
|
| ||
X
| )
| Calculates the approximate geocentric, apparent azimuth
of the Moon in degrees and arcminutes
as it happen at standard set time of the Moon
(geocentric set azimuth). The horizontal angular distance
between the geocentric set azimuth and the West direction is also
known as the geocentric set width of the Moon.
See Standard set time of the Moon,
for further details.
|
|
| ||
Y
| (
| Calculates the approximate geocentric, apparent phase angle
of the Moon in range 0.0...1.0
as it happen at standard rise time of the Moon
(geocentric rise phase angle).
See Standard rise time of the Moon,
for further details.
|
|
| ||
Y
| )
| Calculates the approximate geocentric, apparent phase angle
of the Moon in range 0.0...1.0
as it happen at standard set time of the Moon
(geocentric set phase angle).
See Standard set time of the Moon,
for further details.
|
If no mode is given, Gcal automatically uses that mode, which is enabled by the mode character ‘5’. If a mode character is given that is not according to one of the ‘0’...‘9’, ‘a’...‘z’ and ‘A’...‘Y’ characters, Gcal also automatically uses that mode, which is enabled by the mode character ‘5’.
Depending on the selected mode, Gcal represents the Moon oriented special texts using the same types and styles as they are used by the Sun oriented special texts, these are analogously valid! See Representation of the Sun oriented special texts, for the detailed description of the different types of representation used by the Sun oriented special texts, which are likewise valid for the Moon oriented special texts.
The argument the Moon oriented special texts must have is exactly equivalent the argument the Sun oriented special texts must have! See Arguments of the Sun oriented special texts, for the detailed description of the components of the argument which also has to be given to the Moon oriented special texts.
The following table informs you about which type of representation is caused by a mode. The previously defined numbering scheme, as it has been used for the introduction of the types of representation, is used as key value in the column that holds the type of representation. The table also contains a column that shows whether a mode enables dynamical values, i.e. values that are depending on the respective clocktime (if you use the --time-offset=argument option, you can change the respective clocktime that is used for calculating such values). In a next table column, it is listed whether the given co-ordinate of the location influences the determination of a value, and the last column of the table gives you the information whether a given timezone value affects the values determination:
And now some examples to these special texts:
The text ‘Moonrise at %(+5158+00738,120 in MS, BRD’ will be expanded to
==> ‘Moonrise at 12:21 in MS, BRD’, in case the actual system date is the 1st June 1998.
The text ‘Moonset at %)*5+5158+00738,120 in MS, BRD’ will be expanded to
==> ‘Moonset at 01:53am in MS, BRD’, in case the actual system date is the 1st June 1998.
The text ‘Moon visible %[5+5158+00738,120 in MS, BRD’ will be expanded to
==> ‘Moon visible 13h32' in MS, BRD’, in case the actual system date is the 1st June 1998.
The text ‘Moon non-visible %]*+5158+00738,120 in MS, BRD’ will be expanded to
==> ‘Moon non-visible 10.469 in MS, BRD’, in case the actual system date is the 1st June 1998.
The text ‘Moon azimuth 0 o'clock=%(*a+5158+00738,120 in MS, BRD’ will be expanded to
==> ‘Moon azimuth 0 o'clock=267d37' in MS, BRD’, in case the actual system date is the 1st June 1998.
The text ‘Moonphase %(x+00+000 =%(*m+5158+00738,120 % in MS, BRD’ will be expanded to
==> ‘Moonphase +16h00'=45.248% in MS, BRD’, in case you call Gcal with the --time-offset=16: option and the actual system date is the 1st June 1998.
The text ‘Julian date at %(x+00+000 =%(y+00+000’ will be expanded to
==> ‘Julian date at +10h15'=2450965.927’, in case you call Gcal with the --time-offset=10:15 option and the actual system date is the 1st June 1998.
Here is a list that reports about the used reference systems in a short manner, describes other aspects that are unmentioned now, and informs about the lacks and limitations that are existing for the Moon oriented special texts:
Please also note the following references:
All Moon oriented special texts must always be trailed by a whitespace character which is removed in output!
%[format]-[argument] special text
%[format]-[argument] references the contents
of an environment variable, e.g.:
The text ‘I am `%-USER '-user’ will be expanded to
==> ‘I am `guest'-user’, in case you logged-in as guest on your system.
This special text must always be trailed by a whitespace character which is removed in output!
%? special textsApart from further useful difference values, the text of a fixed date can be provided with different texts used for highlighting.
%[format]? special textsThe use of the other difference values as listed here is to calculate distance values between two dates. In case these special texts are directly lead by a ‘-’ character, e.g. ‘-%d’, Gcal switches the sign of the computed value.
You may depreciate the special meaning of the ‘-’ character —in case this character itself is needed— by placing a ‘\’ (backslash) character before it, e.g. ‘\-’. If you need the ‘\-’ characters themselves, you have to protect the ‘\’ (backslash) character by another ‘\’ (backslash) character, e.g. ‘\\-’.
The following other difference values %[format]?
special texts are respected:
%dThe resource file line ‘0 %d days gone’ will be expanded to
==> ‘-10 days gone’, in case you call Gcal with the -c10- option and no command.
%w%m%yAn example:
Supposing, the actual system date is the 4th September 1999. To calculate, how many days, weeks, months and years are between the actual system date and the birthday of a person, who is born on 21st September 1962, Gcal can be called as follows:
| $ gcal -f/dev/null -Ux -u -#'19620921 %y %m %w %d~' 1962 -| -| -37 -444 -1928 -13497 -| $ gcal -f/dev/null -Ux -u -#'19620921 \\-%y \-%m %w -%d~' 1962 -| -| \--37 --444 -1928 13497 -| $ gcal -f/dev/null -Ux -u -#'00000904 %y %m %w %d~' %19620921 1999 -| -| 37 444 1928 13497 -| $ gcal -f/dev/null -Ux -u -#'00000904 %y %B19620921' %19620921 1962 -| -| 37 36 |
Please do not confound the relative year number %[format]y
special text with the age value %B special text
(see Age value %[format]B[date] special text).
The %y special text counts started years as complete years,
while the %B special text does not.
%? special texts
The following highlighting %? special texts
are respected:
%1%1 is replaced by the starting highlighting sequence respectively
the starting marking character that is used for highlighting the actual day
(see Global option --highlighting=text).
This attains, that all succeeding text of the line after this special text is
displayed in the same way as the highlighted respectively marked actual day.
%1 is used together with the %2 special text, which turns off
this enabled highlighting sequence respectively produces the ending marking
character. If a %1 text is not succeeded by a %2 text on the
line, Gcal automatically inserts such a %2 text at the end of the line.
For example:
Only %1THIS%2 word is highlighted in this line.
%1This text is highlighted up to%2 here.
All from %1here up to the end of the line is highlighted.
%2%2 is replaced by the ending highlighting sequence respectively
the ending marking character that is used for highlighting the actual
day. This attains, that a possibly active highlighting according to
the actual day is turned off respectively an ending marking character
is produced. %2 is used together with the %1 special text.
The %2 text has no affect if no preceding %1 text was
found on the line.
%3%3 is replaced by the starting highlighting sequence respectively
the starting marking character that is used for highlighting a holiday,
(see Global option --highlighting=text).
This attains, that all succeeding text of the line after this special text
is displayed in the same way as the highlighted respectively marked holiday.
%3 is used together with the %4 special text, which turns off
this enabled highlighting sequence respectively produces the ending marking
character. If a %3 text is not succeeded by a %4 text on the
line, Gcal automatically inserts such a %4 text at the end of the line.
For example:
Only %3THIS%4 word is highlighted in this line.
%3This text is highlighted up to%4 here.
All from %3here up to the end of the line is highlighted.
%4%4 is replaced by the ending highlighting sequence respectively
the ending marking character that is used for highlighting a holiday.
This attains, that a possibly active highlighting according to a holiday
is turned off respectively an ending marking character is produced.
%4 is used together with the %3 special text. The %4
text has no affect if no preceding %3 text was found on the line.
%5%5 is replaced by the starting highlighting sequence respectively
the starting marking character that is used for highlighting the actual day
if a fixed date is on today's date,
(see Global option --highlighting=text).
This attains, that all succeeding text of the line after this special text is
displayed in the same way as the highlighted respectively marked actual day.
%5 is used together with the %6 special text, which turns off
this enabled highlighting sequence respectively produces the ending marking
character. If a %5 text is not succeeded by a %6 text on the
line, Gcal automatically inserts such a %6 text at the end of the line.
%6%6 is replaced by the ending highlighting sequence respectively
the ending marking character that is used for highlighting the actual
day if a fixed date is on today's date. This attains, that a possibly
active highlighting according to the actual day is turned off respectively
an ending marking character is produced. %6 is used together with
the %5 special text. The %6 text has no affect if no
preceding %5 text was found on the line.
%7%7 is replaced by the starting highlighting sequence respectively
the starting marking character that is used for highlighting a holiday
if a fixed date is on a legal holiday date,
(see Global option --highlighting=text).
This attains, that all succeeding text of the line after this special text
is displayed in the same way as the highlighted respectively marked holiday.
%7 is used together with the %8 special text, which turns off
this enabled highlighting sequence respectively produces the ending marking
character. If a %7 text is not succeeded by a %8 text on the
line, Gcal automatically inserts such a %8 text at the end of the line.
%8%8 is replaced by the ending highlighting sequence respectively
the ending marking character that is used for highlighting a holiday if
a fixed date is on a legal holiday date. This attains, that a possibly
active highlighting according to a holiday is turned off respectively an
ending marking character is produced. %8 is used together with the
%7 special text. The %8 text has no affect if no preceding
%7 text was found on the line.
%9%9 is replaced by the starting highlighting sequence respectively the
starting marking character that is used for highlighting the actual day if a
fixed date is on today's date; otherwise %9 is replaced by the starting
highlighting sequence respectively the starting marking character that is used
for highlighting a holiday if a fixed date is on a legal holiday date,
(see Global option --highlighting=text).
This attains, that all succeeding text of the line after this special text
is displayed in the same way as the highlighted respectively marked actual
day or holiday. %9 is used together with the %0 special text,
which turns off this enabled highlighting sequence respectively produces
the ending marking character. If a %9 text is not succeeded by a
%0 text on the line, Gcal automatically inserts such a %0
text at the end of the line.
%0%0 is replaced by the ending highlighting sequence respectively the
ending marking character that is used for highlighting the actual day if a
fixed date is on today's date; otherwise %0 is replaced by the ending
highlighting sequence respectively the ending marking character that is used
for highlighting a holiday if a fixed date is on a legal holiday date.
This attains, that a possibly active highlighting according to today's date
or a holiday is turned off respectively an ending marking character is produced.
%0 is used together with the %9 special text. The %0 text
has no affect if no preceding %9 text was found on the line.